BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_M21 (648 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 23 2.2 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 2.2 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 3.8 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 5.0 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 6.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 6.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 6.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 6.6 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 6.6 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -2 Query: 317 YSSDTKCTHSGKSSTVALFLPKSKIRILGS 228 Y+ D CTH +++ P+S +GS Sbjct: 365 YNQDVSCTHYQNPEYISVVNPESPYPQIGS 394 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +2 Query: 122 SFCVYFRSPWGAGQRDATGTAKINRIRNRGSVGVY 226 S+ +F SP G TGT RG++G Y Sbjct: 40 SYQHHFNSPAGNAHTGPTGTHDAGFPSPRGALGAY 74 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 309 GHQVHAQWKVVN 274 GH +HAQ VVN Sbjct: 327 GHHIHAQHHVVN 338 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 316 IRRTPSARTVESRQRSLSSYP 254 I RTP + R+R L YP Sbjct: 48 IMRTPEQMFLADRERGLKYYP 68 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 575 GGRHRSSRLCAVPSSSSP 628 G RSSR+C SS P Sbjct: 145 GSLFRSSRMCFFKSSKKP 162 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 575 GGRHRSSRLCAVPSSSSP 628 G RSSR+C SS P Sbjct: 145 GSLFRSSRMCFFKSSKKP 162 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 575 GGRHRSSRLCAVPSSSSP 628 G RSSR+C SS P Sbjct: 145 GSLFRSSRMCFFKSSKKP 162 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 575 GGRHRSSRLCAVPSSSSP 628 G RSSR+C SS P Sbjct: 145 GSLFRSSRMCFFKSSKKP 162 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 316 IRRTPSARTVESRQRSLSSYP 254 I RTP + R+R L YP Sbjct: 48 IMRTPEQLFLAERERGLKYYP 68 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,813 Number of Sequences: 336 Number of extensions: 3651 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -