BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_M01 (554 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 46 2e-05 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 45 4e-05 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 44 7e-05 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 44 7e-05 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 44 7e-05 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 44 7e-05 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 44 9e-05 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 42 2e-04 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 42 4e-04 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 42 4e-04 At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RS... 42 4e-04 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 42 4e-04 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 41 5e-04 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 41 5e-04 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 41 6e-04 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 40 8e-04 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 40 0.001 At1g69250.1 68414.m07936 nuclear transport factor 2 (NTF2) famil... 39 0.003 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 38 0.003 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 38 0.003 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 38 0.005 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 38 0.005 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 38 0.005 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 38 0.005 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 38 0.005 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 37 0.008 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 37 0.008 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 37 0.008 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 37 0.008 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 37 0.010 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 37 0.010 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 36 0.014 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 36 0.014 At1g69250.2 68414.m07935 nuclear transport factor 2 (NTF2) famil... 36 0.014 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 36 0.024 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 36 0.024 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 36 0.024 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 36 0.024 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 36 0.024 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 35 0.032 At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing ... 35 0.032 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 35 0.032 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 35 0.032 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 35 0.042 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 35 0.042 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 35 0.042 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 34 0.055 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 34 0.073 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 34 0.073 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 34 0.073 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 34 0.073 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 34 0.073 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 34 0.073 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 33 0.097 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 33 0.097 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 33 0.13 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 33 0.13 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 33 0.13 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 33 0.13 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 33 0.17 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 33 0.17 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 33 0.17 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 32 0.22 At1g43680.1 68414.m05018 hypothetical protein 32 0.22 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 32 0.30 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 32 0.30 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 32 0.30 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 32 0.30 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 32 0.30 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 32 0.30 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 32 0.30 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 31 0.39 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 31 0.39 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 31 0.39 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 31 0.39 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 31 0.39 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 31 0.52 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 31 0.52 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 31 0.68 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 30 0.90 At1g31550.1 68414.m03871 GDSL-motif lipase, putative similar to ... 30 0.90 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 30 0.90 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 30 1.2 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 30 1.2 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 30 1.2 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 30 1.2 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 30 1.2 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 30 1.2 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 29 1.6 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 29 1.6 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 29 1.6 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 29 1.6 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 29 1.6 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 29 1.6 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 29 2.1 At5g51300.2 68418.m06360 splicing factor-related contains simila... 29 2.1 At5g51300.1 68418.m06359 splicing factor-related contains simila... 29 2.1 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 29 2.1 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 29 2.1 At2g47310.1 68415.m05906 flowering time control protein-related ... 29 2.1 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 29 2.1 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 29 2.1 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 29 2.1 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 29 2.1 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 29 2.8 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 29 2.8 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 29 2.8 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 29 2.8 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 29 2.8 At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) famil... 28 3.6 At5g22930.1 68418.m02681 hypothetical protein 28 3.6 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 28 3.6 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 28 3.6 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 28 3.6 At2g40475.1 68415.m04995 expressed protein 28 3.6 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 28 3.6 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 27 6.4 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 27 6.4 At1g13730.1 68414.m01612 nuclear transport factor 2 (NTF2) famil... 27 6.4 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 27 8.4 At4g30250.1 68417.m04301 AAA-type ATPase family protein contains... 27 8.4 At1g27650.1 68414.m03379 U2 snRNP auxiliary factor small subunit... 27 8.4 At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-l... 27 8.4 At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-l... 27 8.4 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 46.0 bits (104), Expect = 2e-05 Identities = 22/60 (36%), Positives = 33/60 (55%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNSTFNGG 310 V+VG+ ++ DL +LF +FG V D+ + FV+ + E A AIR N+TF G Sbjct: 4 VYVGNFDYDTRHSDLERLFSKFGRVKRVDMKSGYAFVYFEDERDAEDAIRRTDNTTFGYG 63 Score = 38.3 bits (85), Expect = 0.003 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +2 Query: 119 PQTKVFVGSL-PQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNS 295 P +FV + P ++ D+ + FE +G V + FV T+E A A+ + HNS Sbjct: 93 PTKTLFVINFDPIRTRERDMERHFEPYGKVLNVRMRRNFAFVQFATQEDATKALDSTHNS 152 Query: 296 TFNGGVISVE 325 V+SVE Sbjct: 153 KLLDKVVSVE 162 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 44.8 bits (101), Expect = 4e-05 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 7/67 (10%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRA 283 T V+V +L + E+L K+F FGV T C IM GFV+ + + AA A+ A Sbjct: 224 TNVYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDGEGKSKGFGFVNFENSDDAARAVDA 283 Query: 284 LHNSTFN 304 L+ TF+ Sbjct: 284 LNGKTFD 290 Score = 31.1 bits (67), Expect = 0.52 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 7/62 (11%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRA 283 + ++V +L + + LR+ F FG +T C +M GFV T E+A AI Sbjct: 327 SNLYVKNLDESVTDDKLREHFAPFGTITSCKVMRDPSGVSRGSGFVAFSTPEEATRAITE 386 Query: 284 LH 289 ++ Sbjct: 387 MN 388 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 44.0 bits (99), Expect = 7e-05 Identities = 29/75 (38%), Positives = 40/75 (53%), Gaps = 9/75 (12%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIRA 283 K+FVGS+P+ + E++R FE+ G V E ++ C FV T + A AIRA Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRA 180 Query: 284 LHNS-TFNGGVISVE 325 LHN T GG V+ Sbjct: 181 LHNQITLPGGTGPVQ 195 Score = 35.5 bits (78), Expect = 0.024 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 7/65 (10%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRAL 286 K+FVGSL + + +++ ++F +FG V + +M CGFV ++E A AAI L Sbjct: 212 KLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVKYSSKETAMAAIDGL 271 Query: 287 HNSTF 301 N T+ Sbjct: 272 -NGTY 275 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 44.0 bits (99), Expect = 7e-05 Identities = 29/75 (38%), Positives = 40/75 (53%), Gaps = 9/75 (12%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIRA 283 K+FVGS+P+ + E++R FE+ G V E ++ C FV T + A AIRA Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRA 180 Query: 284 LHNS-TFNGGVISVE 325 LHN T GG V+ Sbjct: 181 LHNQITLPGGTGPVQ 195 Score = 35.5 bits (78), Expect = 0.024 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 7/65 (10%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRAL 286 K+FVGSL + + +++ ++F +FG V + +M CGFV ++E A AAI L Sbjct: 212 KLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVKYSSKETAMAAIDGL 271 Query: 287 HNSTF 301 N T+ Sbjct: 272 -NGTY 275 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 44.0 bits (99), Expect = 7e-05 Identities = 23/77 (29%), Positives = 45/77 (58%), Gaps = 7/77 (9%) Frame = +2 Query: 116 VPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDI------MNR-CGFVHMQTEEQAAAA 274 + +T++ ++P S PED+R LFE++G V + ++ NR F+ M + E+AA A Sbjct: 91 ISKTRLIAQNVPWTSTPEDIRSLFEKYGSVIDIEMSMHKKERNRGLVFIEMASPEEAATA 150 Query: 275 IRALHNSTFNGGVISVE 325 +++L + + G + V+ Sbjct: 151 LKSLESCEYEGRRLKVD 167 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 44.0 bits (99), Expect = 7e-05 Identities = 21/57 (36%), Positives = 32/57 (56%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNSTF 301 VFVG+ ++ DL +LF+++G V D+ + FV+ + E A AIR L N F Sbjct: 4 VFVGNFEYETRQSDLERLFDKYGRVDRVDMKSGYAFVYFEDERDAEDAIRKLDNFPF 60 Score = 41.9 bits (94), Expect = 3e-04 Identities = 25/70 (35%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +2 Query: 119 PQTKVFVGSL-PQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNS 295 P +FV + P +K D+ K FE +G VT I FV +T+E A A+ A S Sbjct: 91 PTKTLFVINFDPIRTKEHDIEKHFEPYGKVTNVRIRRNFSFVQFETQEDATKALEATQRS 150 Query: 296 TFNGGVISVE 325 V+SVE Sbjct: 151 KILDRVVSVE 160 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 43.6 bits (98), Expect = 9e-05 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 8/68 (11%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAIRA 283 ++FVGSL +G+ EDL+K+F G VTE I+ F+ T EQA A++ Sbjct: 215 EIFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKE 274 Query: 284 LHNSTFNG 307 L + NG Sbjct: 275 LKSPMING 282 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 42.3 bits (95), Expect = 2e-04 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 7/73 (9%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM------NRC-GFVHMQTEEQAAAAIRA 283 T V+V +LP+ ++LRK F +FGV++ +M +RC GFV+ + E AA+A+ Sbjct: 229 TNVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQSGNSRCFGFVNFECTEAAASAVEK 288 Query: 284 LHNSTFNGGVISV 322 ++ + V+ V Sbjct: 289 MNGISLGDDVLYV 301 Score = 29.9 bits (64), Expect = 1.2 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 7/65 (10%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTEC----DIMNRC---GFVHMQTEEQAAAAIRALH 289 +F+ +L + L + F FG + C D+ R GFV + EE A AAI L+ Sbjct: 138 IFIKNLDASIDNKALFETFSSFGTILSCKVAMDVTGRSKGYGFVQFEKEESAQAAIDKLN 197 Query: 290 NSTFN 304 N Sbjct: 198 GMLMN 202 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 41.5 bits (93), Expect = 4e-04 Identities = 20/52 (38%), Positives = 29/52 (55%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRAL 286 VF G+ ++ DL +LF ++G V D+ FV+M+ E A AIRAL Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRAL 55 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 41.5 bits (93), Expect = 4e-04 Identities = 20/52 (38%), Positives = 29/52 (55%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRAL 286 VF G+ ++ DL +LF ++G V D+ FV+M+ E A AIRAL Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRAL 55 >At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 350 Score = 41.5 bits (93), Expect = 4e-04 Identities = 21/57 (36%), Positives = 30/57 (52%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNSTF 301 VF G+ ++ DL +LF ++G V D+ FV+M+ E A AIRAL F Sbjct: 4 VFCGNFEYDAREGDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALDRFEF 60 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 41.5 bits (93), Expect = 4e-04 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 8/77 (10%) Frame = +2 Query: 119 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECD-----IMNR---CGFVHMQTEEQAAAA 274 P+TK++V L + + LR FE+FG + + + NR F+ +TEE+A A Sbjct: 75 PKTKLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYETEEEAMKA 134 Query: 275 IRALHNSTFNGGVISVE 325 I+ +H +G VI VE Sbjct: 135 IQGMHGKFLDGRVIFVE 151 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 41.1 bits (92), Expect = 5e-04 Identities = 22/67 (32%), Positives = 33/67 (49%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNSTFN 304 T+++VG L ++ DL +LF R+G V + D+ FV A A L F+ Sbjct: 11 TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADDARYYLDGRDFD 70 Query: 305 GGVISVE 325 G I+VE Sbjct: 71 GSRITVE 77 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 41.1 bits (92), Expect = 5e-04 Identities = 22/67 (32%), Positives = 33/67 (49%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNSTFN 304 T+++VG L ++ DL +LF R+G V + D+ FV A A L F+ Sbjct: 11 TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFGDPRDADDARHYLDGRDFD 70 Query: 305 GGVISVE 325 G I+VE Sbjct: 71 GSRITVE 77 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 40.7 bits (91), Expect = 6e-04 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 8/74 (10%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAIR 280 TK+++G L G+ L+ F F VTE +M GFV+ +E+ A +AI Sbjct: 31 TKLYIGGLSPGTDEHSLKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAIS 90 Query: 281 ALHNSTFNGGVISV 322 A++ NG ISV Sbjct: 91 AMNGQELNGFNISV 104 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 40.3 bits (90), Expect = 8e-04 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 10/83 (12%) Frame = +2 Query: 98 YKSVIMVPQ--TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHM 247 Y ++ +P ++VF+G LP+ EDLR L E G + E +M FV Sbjct: 105 YSHLLSLPPHGSEVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAF 164 Query: 248 QTEEQAAAAIRALHNSTFNGGVI 316 +T++ A AI LH+ F G I Sbjct: 165 KTKDVAQKAIEELHSKEFKGKTI 187 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 39.9 bits (89), Expect = 0.001 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 7/64 (10%) Frame = +2 Query: 119 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAI 277 P+ K+FVG LP+ +++ LF +G + + I+ C F+ +++EQA AA+ Sbjct: 107 PEHKLFVGMLPKNVSETEVQSLFSEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAM 166 Query: 278 RALH 289 AL+ Sbjct: 167 EALN 170 >At1g69250.1 68414.m07936 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) Length = 427 Score = 38.7 bits (86), Expect = 0.003 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 10/77 (12%) Frame = +2 Query: 101 KSVIMVPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR---------C-GFVHMQ 250 + VI VP T +FV +LP + P L +LF+ FG + E I R C GF+ + Sbjct: 272 QKVIEVPGTSIFVANLPLNAMPPQLFELFKDFGPIKENGIQVRSSRGNANPVCFGFISFE 331 Query: 251 TEEQAAAAIRALHNSTF 301 T + ++A N+ F Sbjct: 332 TVASVQSVLQAAKNTPF 348 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 38.3 bits (85), Expect = 0.003 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--NRCGFVHMQTEEQAAAAIRALHNST 298 T +FVG++ Q +DL+ +F +FG + I RCGFV A A+ L+ + Sbjct: 278 TTIFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQALSVLNGTQ 337 Query: 299 FNG 307 G Sbjct: 338 LGG 340 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 38.3 bits (85), Expect = 0.003 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +2 Query: 119 PQTKVFVGSL-PQGSKPEDLRKLFERFGVVTECDIMNRCGFVHMQTEEQAAAAIRALHNS 295 P +FV + P ++ D+ + FE +G V + FV T+E A A+ + HNS Sbjct: 67 PTKTLFVINFDPIRTRERDMERHFEPYGKVLNVRMRRNFAFVQFATQEDATKALDSTHNS 126 Query: 296 TFNGGVISVE 325 V+SVE Sbjct: 127 KLLDKVVSVE 136 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 37.9 bits (84), Expect = 0.005 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 8/74 (10%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIR 280 +++FVG L DL + F RFG + +C IM GF+ +IR Sbjct: 7 SRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIR 66 Query: 281 ALHNSTFNGGVISV 322 +H F VISV Sbjct: 67 EMHGRDFGDRVISV 80 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 7/61 (11%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRAL 286 K+FVG LP+ +++ LF ++G + + I+ C F+ +T+EQA +A+ ++ Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYETKEQAVSAMESI 166 Query: 287 H 289 + Sbjct: 167 N 167 Score = 33.5 bits (73), Expect = 0.097 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 8/63 (12%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIRA 283 K+FVG +P+ L LF+ F VV E +I+ C F+ + E+A + A Sbjct: 19 KLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNA 78 Query: 284 LHN 292 HN Sbjct: 79 CHN 81 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 7/61 (11%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRAL 286 K+FVG LP+ +++ LF ++G + + I+ C F+ +T+EQA +A+ ++ Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYETKEQAVSAMESI 166 Query: 287 H 289 + Sbjct: 167 N 167 Score = 33.5 bits (73), Expect = 0.097 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 8/63 (12%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIRA 283 K+FVG +P+ L LF+ F VV E +I+ C F+ + E+A + A Sbjct: 19 KLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNA 78 Query: 284 LHN 292 HN Sbjct: 79 CHN 81 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 37.9 bits (84), Expect = 0.005 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 8/75 (10%) Frame = +2 Query: 122 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAI 277 ++++FVG L L F+R+G +TEC IM GF+ A AI Sbjct: 11 ESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAI 70 Query: 278 RALHNSTFNGGVISV 322 + +H VISV Sbjct: 71 KHMHGRELGNKVISV 85 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 37.9 bits (84), Expect = 0.005 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 8/75 (10%) Frame = +2 Query: 122 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAI 277 ++++FVG L L F+R+G +TEC IM GF+ A AI Sbjct: 11 ESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAI 70 Query: 278 RALHNSTFNGGVISV 322 + +H VISV Sbjct: 71 KHMHGRELGNKVISV 85 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 37.1 bits (82), Expect = 0.008 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 8/74 (10%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIR 280 +K+FVG L G+ L++ F FG VTE ++ GFV E+ A AI+ Sbjct: 35 SKLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIK 94 Query: 281 ALHNSTFNGGVISV 322 + NG I V Sbjct: 95 EMDGKELNGRQIRV 108 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 37.1 bits (82), Expect = 0.008 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 8/74 (10%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIR 280 +K+FVG L G+ L++ F FG VTE ++ GFV E+ A AI+ Sbjct: 35 SKLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIK 94 Query: 281 ALHNSTFNGGVISV 322 + NG I V Sbjct: 95 EMDGKELNGRQIRV 108 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 37.1 bits (82), Expect = 0.008 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--NRCGFVHMQTEEQAAAAIRALHNST 298 T VFVG L + L+ +F ++G + I RCGFV + A A+R L+ Sbjct: 261 TTVFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQ 320 Query: 299 FNGGVI 316 G + Sbjct: 321 LGGTTV 326 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 37.1 bits (82), Expect = 0.008 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 7/61 (11%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRAL 286 K+FVG LP+ +++ LF +G + + I+ C F+ +++EQA AA+ AL Sbjct: 101 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAMEAL 160 Query: 287 H 289 + Sbjct: 161 N 161 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 36.7 bits (81), Expect = 0.010 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 8/75 (10%) Frame = +2 Query: 122 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-NR-------CGFVHMQTEEQAAAAI 277 + K+FVG+LP + L LFE+ G V +++ NR GFV M T E+A A+ Sbjct: 112 EAKLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAV 171 Query: 278 RALHNSTFNGGVISV 322 ++ NG ++V Sbjct: 172 EKFNSFEVNGRRLTV 186 Score = 32.3 bits (70), Expect = 0.22 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 8/73 (10%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN--------RCGFVHMQTEEQAAAAIRA 283 +++VG+LP L +LF G V + +++ GFV M E + AI A Sbjct: 208 RIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAA 267 Query: 284 LHNSTFNGGVISV 322 L G I V Sbjct: 268 LDGQNLEGRAIKV 280 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 36.7 bits (81), Expect = 0.010 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 5/62 (8%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN-----RCGFVHMQTEEQAAAAIRALH 289 TK+FVG+L + +DLR+ FE+FG V + ++++ R T + +RAL Sbjct: 12 TKIFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTVRALQ 71 Query: 290 NS 295 NS Sbjct: 72 NS 73 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 36.3 bits (80), Expect = 0.014 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--NRCGFVHMQTEEQAAAAIRALHNST 298 T +FVG L ++L+ +F +FG + I RCGFV + A A+ L+ + Sbjct: 260 TTIFVGGLDANVTDDELKSIFGQFGELLHVKIPPGKRCGFVQYANKASAEHALSVLNGTQ 319 Query: 299 FNG 307 G Sbjct: 320 LGG 322 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 36.3 bits (80), Expect = 0.014 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRCG--FVHMQTEEQAAAAIRALHNSTFN 304 ++VGSL + DL +LF R+G + + + G F++ + E+A AA AL + N Sbjct: 20 LWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGFAFIYYRHVEEAVAAKEALQGANLN 79 Query: 305 G 307 G Sbjct: 80 G 80 >At1g69250.2 68414.m07935 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) Length = 389 Score = 36.3 bits (80), Expect = 0.014 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +2 Query: 101 KSVIMVPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR 229 + VI VP T +FV +LP + P L +LF+ FG + E I R Sbjct: 272 QKVIEVPGTSIFVANLPLNAMPPQLFELFKDFGPIKENGIQVR 314 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 35.5 bits (78), Expect = 0.024 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 8/73 (10%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN--------RCGFVHMQTEEQAAAAIRA 283 + FVG L + EDL++ F +FG V + I+N GFV + E+ AI Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEE 66 Query: 284 LHNSTFNGGVISV 322 ++ +G VI+V Sbjct: 67 MNGKELDGRVITV 79 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 35.5 bits (78), Expect = 0.024 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 8/73 (10%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN--------RCGFVHMQTEEQAAAAIRA 283 + FVG L + EDL++ F +FG V + I+N GFV + E+ AI Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEE 66 Query: 284 LHNSTFNGGVISV 322 ++ +G VI+V Sbjct: 67 MNGKELDGRVITV 79 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 35.5 bits (78), Expect = 0.024 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 8/73 (10%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN--------RCGFVHMQTEEQAAAAIRA 283 + FVG L + EDL++ F +FG V + I+N GFV + E+ AI Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEE 66 Query: 284 LHNSTFNGGVISV 322 ++ +G VI+V Sbjct: 67 MNGKELDGRVITV 79 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 35.5 bits (78), Expect = 0.024 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 8/74 (10%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIR 280 TK+F+G L G+ LR F FG V + ++ GFV+ E A AAI Sbjct: 35 TKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAIS 94 Query: 281 ALHNSTFNGGVISV 322 + NG I V Sbjct: 95 EMDGKELNGRHIRV 108 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 35.5 bits (78), Expect = 0.024 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 8/74 (10%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIR 280 TK+F+G L G+ LR F FG V + ++ GFV+ E A AAI Sbjct: 35 TKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAIS 94 Query: 281 ALHNSTFNGGVISV 322 + NG I V Sbjct: 95 EMDGKELNGRHIRV 108 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 35.1 bits (77), Expect = 0.032 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 8/76 (10%) Frame = +2 Query: 122 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDI-------MNR-CGFVHMQTEEQAAAAI 277 + V V +L + ++ DL +LF FG VT C + M+R GFV + E A AI Sbjct: 173 ENSVRVTNLSEDTRGPDLMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAI 232 Query: 278 RALHNSTFNGGVISVE 325 L+ ++ ++ VE Sbjct: 233 NKLNGYGYDNLILRVE 248 >At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 823 Score = 35.1 bits (77), Expect = 0.032 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Frame = +2 Query: 119 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--NRCGFVHMQTEEQAAAAIRALHN 292 P ++VG+LP G +L F RFG + FV+ +E A AAI +L Sbjct: 21 PSRHLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESLQG 80 Query: 293 STFNGGVISVE 325 +G + +E Sbjct: 81 FPLSGNPLRIE 91 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 35.1 bits (77), Expect = 0.032 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM--NRCGFVHMQTEEQAAAAIRALHNSTFN 304 +FVG + EDLR+ F +FG V I CGFV + A AI +L+ + Sbjct: 323 IFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIG 382 Query: 305 GGVI 316 + Sbjct: 383 KNTV 386 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 35.1 bits (77), Expect = 0.032 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +2 Query: 116 VPQTKVFVGSLPQGSKPEDLRKLFERFG--VVTECDIMNRCGFVHMQTEEQAAAAIRALH 289 + T +FVG L EDL++ F FG V + + CGFV A A+ L+ Sbjct: 301 IMNTTIFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLN 360 Query: 290 NS 295 + Sbjct: 361 GT 362 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 34.7 bits (76), Expect = 0.042 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = +2 Query: 137 VGSLPQGSKPEDLRKLFERFGVVTECDIMN--RCGFVHMQTEEQAAAAIRALHNSTFNGG 310 V +L E LR+LF G V +C I + ++ E+A AA+ AL+N+ G Sbjct: 355 VSNLSPSLTTEQLRQLFSFCGTVVDCSITDSKHIAYIEYSNSEEATAAL-ALNNTEVFGR 413 Query: 311 VISVE 325 ++VE Sbjct: 414 ALNVE 418 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 34.7 bits (76), Expect = 0.042 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFG--VVTECDIMNRCGFVHMQTEEQAAAAIRALHNS 295 T +FVG L EDL++ F FG V + + CGFV A A+ L+ + Sbjct: 306 TTIFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLNGT 364 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 34.7 bits (76), Expect = 0.042 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +2 Query: 101 KSVIMVP-QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN 226 K ++M Q KV+VG+LP ++P+ LR F +FG + +++ Sbjct: 203 KKILMYESQHKVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLH 245 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 34.3 bits (75), Expect = 0.055 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 7/62 (11%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRA 283 T V+V +L + + DL++LF FG +T +M R GFV+ + E A AI Sbjct: 119 TNVYVKNLVETATDADLKRLFGEFGEITSAVVMKDGEGKSRRFGFVNFEKAEAAVTAIEK 178 Query: 284 LH 289 ++ Sbjct: 179 MN 180 Score = 30.3 bits (65), Expect = 0.90 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 7/56 (12%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAI 277 ++V +L L +LF FG +T C +M GFV T E+A+ A+ Sbjct: 225 LYVKNLDDSVDNTKLEELFSEFGTITSCKVMVHSNGISKGVGFVEFSTSEEASKAM 280 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 33.9 bits (74), Expect = 0.073 Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 8/77 (10%) Frame = +2 Query: 119 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAA 274 P T +FV L + + E LR F +FG V + ++ GFV T E +A Sbjct: 54 PSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKG 113 Query: 275 IRALHNSTFNGGVISVE 325 I + +G VI E Sbjct: 114 IAGMDGKFLDGWVIFAE 130 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 33.9 bits (74), Expect = 0.073 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 8/72 (11%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAIRAL 286 + + +LP ++P DLR FERFG + + + GFV + E AA A++ + Sbjct: 49 LLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAEAMKRM 108 Query: 287 HNSTFNGGVISV 322 ++ G I++ Sbjct: 109 NHKVIGGREIAI 120 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 33.9 bits (74), Expect = 0.073 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDI 220 K+FVG LPQ + +DLR F RFG + + I Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYI 271 Score = 30.7 bits (66), Expect = 0.68 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTE 211 T++FV +P D R FER+G +T+ Sbjct: 91 TRIFVARIPSSVSESDFRSHFERYGEITD 119 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 33.9 bits (74), Expect = 0.073 Identities = 26/73 (35%), Positives = 32/73 (43%), Gaps = 8/73 (10%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN--------RCGFVHMQTEEQAAAAIRA 283 KV+VG+L + E L LF G V + GFV +EE AAI A Sbjct: 178 KVYVGNLAKTVTKEMLENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVA 237 Query: 284 LHNSTFNGGVISV 322 L+NS G I V Sbjct: 238 LNNSLLEGQKIRV 250 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 33.9 bits (74), Expect = 0.073 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-----NRCGFVHMQTEEQAAAAIRALH 289 TK+FVG L ++ + +R+ FE+FG + E ++ R T ++A AA+RA Sbjct: 22 TKIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQ 81 Query: 290 N 292 N Sbjct: 82 N 82 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 33.9 bits (74), Expect = 0.073 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 7/68 (10%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTE----CDIMNRC---GFVHMQTEEQAAAAIRA 283 + ++V ++ E+LRK F + G +T CD + GFV T E+A A++ Sbjct: 304 SNIYVKNVNVAVTEEELRKHFSQCGTITSTKLMCDEKGKSKGFGFVCFSTPEEAIDAVKT 363 Query: 284 LHNSTFNG 307 H F+G Sbjct: 364 FHGQMFHG 371 Score = 33.5 bits (73), Expect = 0.097 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 7/63 (11%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDI-------MNRCGFVHMQTEEQAAAAIRALH 289 VFV +LP+ L+ +F++FG + C + GFV + E+ A AAI+ L Sbjct: 114 VFVKNLPESVTNAVLQDMFKKFGNIVSCKVATLEDGKSRGYGFVQFEQEDAAHAAIQTL- 172 Query: 290 NST 298 NST Sbjct: 173 NST 175 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.5 bits (73), Expect = 0.097 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 8/75 (10%) Frame = +2 Query: 122 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM-NR-------CGFVHMQTEEQAAAAI 277 + K+FVG+L + L LFE+ G V +++ NR GFV M + ++A A+ Sbjct: 149 EAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAV 208 Query: 278 RALHNSTFNGGVISV 322 + NG +++V Sbjct: 209 EKFNRYDLNGRLLTV 223 Score = 29.9 bits (64), Expect = 1.2 Identities = 23/76 (30%), Positives = 31/76 (40%), Gaps = 8/76 (10%) Frame = +2 Query: 119 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAA 274 P +V+VG+LP L +LF G V E ++ GFV M ++ A Sbjct: 242 PAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEA 301 Query: 275 IRALHNSTFNGGVISV 322 I AL G I V Sbjct: 302 ISALDGQNLEGRAIRV 317 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 33.5 bits (73), Expect = 0.097 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 7/72 (9%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM------NR-CGFVHMQTEEQAAAAIRAL 286 K+FV +LP D+ +LF + G V +I+ NR FV M + E+A AAI Sbjct: 96 KLFVFNLPWSMSVNDISELFGQCGTVNNVEIIRQKDGKNRGFAFVTMASGEEAQAAIDKF 155 Query: 287 HNSTFNGGVISV 322 +G +ISV Sbjct: 156 DTFQVSGRIISV 167 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 33.1 bits (72), Expect = 0.13 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 8/69 (11%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN--------RCGFVHMQTEEQAAAAIRA 283 + FVG L + EDL++ F +FG V + I+N GFV + E+ AI Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEE 66 Query: 284 LHNSTFNGG 310 ++ S GG Sbjct: 67 MNGSGGGGG 75 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 33.1 bits (72), Expect = 0.13 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 8/75 (10%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAIR 280 T+V+VG+L + + LR+ F +G V + +M GFV + +A AA+ Sbjct: 3 TRVYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVS 62 Query: 281 ALHNSTFNGGVISVE 325 + NG +SV+ Sbjct: 63 GMDGKELNGRRVSVK 77 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 33.1 bits (72), Expect = 0.13 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 K+FVG LP D + FE+FG T+ +M Sbjct: 109 KIFVGGLPSSVTESDFKTYFEQFGTTTDVVVM 140 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 33.1 bits (72), Expect = 0.13 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 K+FVG LP D + FE+FG T+ +M Sbjct: 109 KIFVGGLPSSVTESDFKTYFEQFGTTTDVVVM 140 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 32.7 bits (71), Expect = 0.17 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 TKVFVG L + +++R+ FE+FG + E I+ Sbjct: 17 TKVFVGGLAWETPTDEMRRYFEQFGEILEAVII 49 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 32.7 bits (71), Expect = 0.17 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 TKVFVG L + +++R+ FE+FG + E I+ Sbjct: 17 TKVFVGGLAWETPTDEMRRYFEQFGEILEAVII 49 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 32.7 bits (71), Expect = 0.17 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIMN 226 K+FVG L + E+ + FERFG T+ +M+ Sbjct: 121 KIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMH 153 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTE 211 K+FVG + + + E L++ F R+G V E Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYGAVLE 34 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 32.3 bits (70), Expect = 0.22 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 2/64 (3%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM--NRCGFVHMQTEEQAAAAIRALHNSTFN 304 +FVG L EDL + F FG V I CGFV + A AI L+ + Sbjct: 329 IFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIG 388 Query: 305 GGVI 316 + Sbjct: 389 KNTV 392 >At1g43680.1 68414.m05018 hypothetical protein Length = 247 Score = 32.3 bits (70), Expect = 0.22 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -3 Query: 234 PHRFIISHSVTTPKRSNSFLRSSGLEPCGRLPTNTF 127 PHRF S + +TP S SFL +SG P R PT F Sbjct: 174 PHRFSSSSNSSTPIASASFLAASGWRPTTR-PTYEF 208 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 31.9 bits (69), Expect = 0.30 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 K+FVG LP E+ + F++FG + + +M Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVVM 142 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 31.9 bits (69), Expect = 0.30 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 K+FVG LP E+ + F++FG + + +M Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVVM 142 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 31.9 bits (69), Expect = 0.30 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 K+FVG LP E+ + F++FG + + +M Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVVM 142 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 31.9 bits (69), Expect = 0.30 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 8/71 (11%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVV--------TECDIMNRCGFVHMQTEEQAAAAIR 280 TK++VG LP ++ E L F+RFG + E D GFV + E A A + Sbjct: 13 TKIYVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACK 72 Query: 281 ALHNSTFNGGV 313 N T G + Sbjct: 73 D-PNPTIEGRI 82 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 31.9 bits (69), Expect = 0.30 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 8/69 (11%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAIR 280 ++V++G +P + DL+ G VTE IM FV ++++ AA AI Sbjct: 92 SEVYLGGIPTDATEGDLKGFCGSIGEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAID 151 Query: 281 ALHNSTFNG 307 L+N+ F G Sbjct: 152 TLNNTDFRG 160 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 31.9 bits (69), Expect = 0.30 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 8/78 (10%) Frame = +2 Query: 116 VPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDI-MNRCG-------FVHMQTEEQAAA 271 V K+F+ L + + LR FE FG + E I M++ F+ TEE A Sbjct: 279 VKTKKLFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLEYTTEEAAGT 338 Query: 272 AIRALHNSTFNGGVISVE 325 A++ ++ NG +I V+ Sbjct: 339 ALKEMNGKIINGWMIVVD 356 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 31.9 bits (69), Expect = 0.30 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 8/69 (11%) Frame = +2 Query: 122 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAI 277 Q +FV L + E+L+ FE +G +TEC ++ GFV +T + A AA+ Sbjct: 162 QRNIFVRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAAL 221 Query: 278 RALHNSTFN 304 + +N Sbjct: 222 KNPEKRMYN 230 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 31.5 bits (68), Expect = 0.39 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 TKVFVG L ++ E LR+ FE++G + E ++ Sbjct: 24 TKVFVGGLAWETQSETLRQHFEQYGEILEAVVI 56 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 31.5 bits (68), Expect = 0.39 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 TKVFVG L + E ++K FE+FG + E ++ Sbjct: 13 TKVFVGGLAWETHKETMKKHFEQFGEILEAVVI 45 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 31.5 bits (68), Expect = 0.39 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 TKVFVG L + E ++K FE+FG + E ++ Sbjct: 13 TKVFVGGLAWETHKETMKKHFEQFGEILEAVVI 45 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 31.5 bits (68), Expect = 0.39 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 TKVFVG L + E ++K FE+FG + E ++ Sbjct: 13 TKVFVGGLAWETHKETMKKHFEQFGEILEAVVI 45 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 31.5 bits (68), Expect = 0.39 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 TKVFVG L + +++R+ F++FG + E I+ Sbjct: 17 TKVFVGGLAWETPTDEMRRYFDQFGEILEAVII 49 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 31.1 bits (67), Expect = 0.52 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 6/65 (9%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR------CGFVHMQTEEQAAAAIRALHN 292 ++V +L L ++F FG + C ++ GFV TE+ A +A ALH Sbjct: 114 LYVKNLDSSITSSCLERMFCPFGSILSCKVVEENGQSKGFGFVQFDTEQSAVSARSALHG 173 Query: 293 STFNG 307 S G Sbjct: 174 SMVYG 178 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 31.1 bits (67), Expect = 0.52 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTEC----DIMNRC---GFVHMQTEEQAAAAIRALH 289 VF+ +L + L + F FG + C D++ R GFV + EE A AAI L+ Sbjct: 134 VFIKNLDASIDNKALYETFSSFGTILSCKVAMDVVGRSKGYGFVQFEKEETAQAAIDKLN 193 Query: 290 NSTFN 304 N Sbjct: 194 GMLLN 198 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 30.7 bits (66), Expect = 0.68 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 8/77 (10%) Frame = +2 Query: 119 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNRC--------GFVHMQTEEQAAAA 274 P +FVG L + + LR++ ++G + ++ GFV +TE++ A Sbjct: 62 PYCTLFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRA 121 Query: 275 IRALHNSTFNGGVISVE 325 H+S +G I V+ Sbjct: 122 YEDAHHSLIDGREIIVD 138 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 30.3 bits (65), Expect = 0.90 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 119 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 P +FV L ++ EDL +F RFG V D++ Sbjct: 241 PDNVLFVCKLNPVTEDEDLHTIFSRFGTVVSADVI 275 >At1g31550.1 68414.m03871 GDSL-motif lipase, putative similar to lipase [Arabidopsis thaliana] GI:1145627; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 391 Score = 30.3 bits (65), Expect = 0.90 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +3 Query: 282 RFTTRHLTAA---SYPWSAVASKNAGSVGAVAVDEVPCAVAWSG 404 RF RHL+A P++ S++ GSVG A + VAW G Sbjct: 300 RFINRHLSACCGVGGPYNFNLSRSCGSVGVEACSDPSKYVAWDG 343 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 30.3 bits (65), Expect = 0.90 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 TKVFVG L ++ E LR+ F+++G + E ++ Sbjct: 24 TKVFVGGLAWETQSETLRRHFDQYGDILEAVVI 56 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 29.9 bits (64), Expect = 1.2 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAIR 280 + +FV L+K+F FG VT I+ G+V ++E A +A+ Sbjct: 77 SSLFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFNSKEDAQSAVE 136 Query: 281 ALHNSTFNGGVISVE 325 A++ F+G I V+ Sbjct: 137 AMNGKFFDGRFILVK 151 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 29.9 bits (64), Expect = 1.2 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 8/72 (11%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDI--------MNRCGFVHMQTEEQAAAAIRAL 286 + V ++P +PE+LR+ FERFG V + I FV A A R++ Sbjct: 49 LLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVDAYDAGEAQRSM 108 Query: 287 HNSTFNGGVISV 322 + +F G I+V Sbjct: 109 NRRSFAGREITV 120 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/77 (23%), Positives = 35/77 (45%), Gaps = 8/77 (10%) Frame = +2 Query: 119 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAA 274 P+ + F+G L + LR FE++G + E ++ GF+ ++ A Sbjct: 5 PEYRCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEA 64 Query: 275 IRALHNSTFNGGVISVE 325 I A++ +G I+V+ Sbjct: 65 IAAMNGMDLDGRTITVD 81 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/66 (25%), Positives = 28/66 (42%), Gaps = 7/66 (10%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-------NRCGFVHMQTEEQAAAAIRALH 289 ++V +L E LR+LF FG +T C +M GFV +A+ + ++ Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGTITSCKVMRDPSGTSKGSGFVAFSAASEASRVLNEMN 389 Query: 290 NSTFNG 307 G Sbjct: 390 GKMVGG 395 Score = 27.1 bits (57), Expect = 8.4 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 7/71 (9%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTEC----DIMNRC---GFVHMQTEEQAAAAIRALH 289 +FV +L + + L + F G + C D M + GFV TE+ A AI L+ Sbjct: 136 LFVKNLDKSVDNKTLHEAFSGCGTIVSCKVATDHMGQSRGYGFVQFDTEDSAKNAIEKLN 195 Query: 290 NSTFNGGVISV 322 N I V Sbjct: 196 GKVLNDKQIFV 206 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 TKVFVG L + LR FE+FG + E ++ Sbjct: 7 TKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVI 39 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 TKVFVG L + LR FE+FG + E ++ Sbjct: 7 TKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVI 39 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 122 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 +TK++V LP ++ E L FERFG + ++ Sbjct: 8 ETKIYVAGLPWITRTEGLISYFERFGEIVYAKVV 41 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 K+FVG L + +K F +FG++T+ +M Sbjct: 34 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVM 65 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 K+FVG L + +K F +FG++T+ +M Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVM 138 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 K+FVG L + +K F +FG++T+ +M Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVM 138 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 29.5 bits (63), Expect = 1.6 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 K+FVG LP + + F++FG + + +M Sbjct: 123 KIFVGGLPSSITEAEFKNYFDQFGTIADVVVM 154 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 8/73 (10%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAAIRA 283 +++VG+LP +L ++F G V + I+ GFV M + E+A A++ Sbjct: 117 RLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQM 176 Query: 284 LHNSTFNGGVISV 322 ++S G + V Sbjct: 177 FNSSQIGGRTVKV 189 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 29.1 bits (62), Expect = 2.1 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 6/75 (8%) Frame = +2 Query: 116 VPQTKVFVGSLPQGSKPEDLRKLFERFGVV----TECDIMNRCGFVHMQTEEQAAA--AI 277 +P + VG++ + +L+ LFE+FG + T C NR GF+ + + AA A Sbjct: 214 IPSRTLLVGNISSNVEDYELKVLFEQFGDIQALHTAC--KNR-GFIMVSYCDIRAAQNAA 270 Query: 278 RALHNSTFNGGVISV 322 RAL N G + + Sbjct: 271 RALQNKLLRGTKLDI 285 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 29.1 bits (62), Expect = 2.1 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = +2 Query: 122 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAI 277 +T +++G LP + + L LF FG + ++ GFV + A A+ Sbjct: 479 ETNLYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAV 538 Query: 278 RALHNSTFNGGVISV 322 +A++ F G ++V Sbjct: 539 QAMNGYRFEGRTLAV 553 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 29.1 bits (62), Expect = 2.1 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = +2 Query: 122 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR--------CGFVHMQTEEQAAAAI 277 +T +++G LP + + L LF FG + ++ GFV + A A+ Sbjct: 479 ETNLYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAV 538 Query: 278 RALHNSTFNGGVISV 322 +A++ F G ++V Sbjct: 539 QAMNGYRFEGRTLAV 553 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 K+FVG +P ++ ++ F +FG + E IM Sbjct: 131 KIFVGGIPSSVDDDEFKEFFMQFGELKEHQIM 162 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 29.1 bits (62), Expect = 2.1 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 8/75 (10%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDI-MNRC-------GFVHMQTEEQAAAAIR 280 +K+F+G L + + L + F + G V E I M+R GFV + ++A A+ Sbjct: 34 SKLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALM 93 Query: 281 ALHNSTFNGGVISVE 325 + NG I V+ Sbjct: 94 EFNGQQLNGRTIFVD 108 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 29.1 bits (62), Expect = 2.1 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 9/75 (12%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVVTEC----DIM--NRCG--FVHMQTEEQAAAAIRA 283 K++V + + + D+R++FE++G VTE D M R F+ + E+ AAI A Sbjct: 111 KLYVAPISKTATEYDIRQVFEKYGNVTEIILPKDKMTGERAAYCFIKYKKVEEGNAAIAA 170 Query: 284 L-HNSTFNGGVISVE 325 L TF G ++ V+ Sbjct: 171 LTEQFTFPGEMLPVK 185 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 29.1 bits (62), Expect = 2.1 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 8/75 (10%) Frame = +2 Query: 116 VPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAA 271 + Q +FV + E+L+ FE +G + EC ++ GFV +T + A Sbjct: 405 IAQRNIFVRGFGWDTTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGARE 464 Query: 272 AIRALHNSTFNGGVI 316 A++ +N V+ Sbjct: 465 ALKRPEKRMYNRIVV 479 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 29.1 bits (62), Expect = 2.1 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 5/70 (7%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-----NRCGFVHMQTEEQAAAAIRALHNS 295 V+VG+LP + ++ LF ++G V + D+ FV A AI Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGY 68 Query: 296 TFNGGVISVE 325 F+G + VE Sbjct: 69 DFDGHRLRVE 78 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 29.1 bits (62), Expect = 2.1 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 5/70 (7%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-----NRCGFVHMQTEEQAAAAIRALHNS 295 V+VG+LP + ++ LF ++G V + D+ FV A AI Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGY 68 Query: 296 TFNGGVISVE 325 F+G + VE Sbjct: 69 DFDGHRLRVE 78 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 29.1 bits (62), Expect = 2.1 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 5/70 (7%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-----NRCGFVHMQTEEQAAAAIRALHNS 295 V+VG+LP + ++ LF ++G V + D+ FV A AI Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGY 68 Query: 296 TFNGGVISVE 325 F+G + VE Sbjct: 69 DFDGHRLRVE 78 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 28.7 bits (61), Expect = 2.8 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 8/76 (10%) Frame = +2 Query: 119 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAA 274 P K+FVG+L L +LFE G V +++ GFV M T + AA Sbjct: 97 PDLKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAA 156 Query: 275 IRALHNSTFNGGVISV 322 + + F G + V Sbjct: 157 AQQFNGYEFEGRPLRV 172 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 28.7 bits (61), Expect = 2.8 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 8/76 (10%) Frame = +2 Query: 119 PQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM--------NRCGFVHMQTEEQAAAA 274 P K+FVG+L L +LFE G V +++ GFV M T + AA Sbjct: 97 PDLKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAA 156 Query: 275 IRALHNSTFNGGVISV 322 + + F G + V Sbjct: 157 AQQFNGYEFEGRPLRV 172 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 116 VPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 V K+FV LP + E L +FE +G + EC ++ Sbjct: 101 VTHRKIFVYGLPWETTRETLVGVFEGYGEIEECTVV 136 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 116 VPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIM 223 V K+FV LP + E L +FE +G + EC ++ Sbjct: 101 VTHRKIFVYGLPWETTRETLVGVFEGYGEIEECTVV 136 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVV 205 +++VG+L +DLRK+FE FG V Sbjct: 286 RLYVGNLHINMSEDDLRKVFESFGSV 311 >At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 459 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 7/58 (12%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR------C-GFVHMQTEEQAAAAIRA 283 ++V +LP S P L ++F+ FG + I R C GFV +T +A+ A Sbjct: 295 IYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQVRSNKQGFCFGFVEFETSSGKQSALEA 352 >At5g22930.1 68418.m02681 hypothetical protein Length = 248 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 122 QTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR-CG 235 QT + G LPQ P K FE V +C I+N CG Sbjct: 186 QTLLLAGPLPQWRHPPPPLKSFEIPPVTVQCPIVNNGCG 224 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 5/70 (7%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-----NRCGFVHMQTEEQAAAAIRALHNS 295 ++VG+LP + ++ LF ++G V + D+ FV + A AI Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDARDADDAIYGRDGY 68 Query: 296 TFNGGVISVE 325 F+G + VE Sbjct: 69 DFDGHHLRVE 78 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 5/70 (7%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIM-----NRCGFVHMQTEEQAAAAIRALHNS 295 ++VG+LP + ++ LF ++G V + D+ FV + A AI Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDARDADDAIYGRDGY 68 Query: 296 TFNGGVISVE 325 F+G + VE Sbjct: 69 DFDGHHLRVE 78 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 116 VPQTKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR 229 V K++VG +P S +++R F GV+ + D R Sbjct: 158 VVPNKLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKMR 195 >At2g40475.1 68415.m04995 expressed protein Length = 193 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/44 (25%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +3 Query: 225 TGAGSCICRQRNKRQQQFAR-FTTRHLTAASYPWSAVASKNAGS 353 + +G+ + + R +Q +F + +RH++ S+ WS+ +S ++ S Sbjct: 75 SSSGNKLSKARTIKQTRFVKTLLSRHVSRPSFSWSSASSSSSSS 118 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTE 211 T + V +L + EDLRK FE+FG V + Sbjct: 36 TSLLVRNLRHDCRQEDLRKSFEQFGPVKD 64 >At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 460 Score = 27.5 bits (58), Expect = 6.4 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 8/59 (13%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR-------C-GFVHMQTEEQAAAAIRA 283 ++V +LP S P L ++F+ FG + I R C GFV +T +A+ A Sbjct: 295 IYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQVRSNKQQGFCFGFVEFETSSGKQSALEA 353 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 27.5 bits (58), Expect = 6.4 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 167 EDLRKLFERFGVVTECDI-MNRCGFVHM--QTEEQAAAAIRALHNSTFNGGVIS 319 +D+ ++G V + N GFV++ Q+ E AAAA RA+H F +IS Sbjct: 459 DDVADECSKYGPVNHIYVDKNSAGFVYLRFQSVEAAAAAQRAMHMRWFAQKMIS 512 >At1g13730.1 68414.m01612 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) Length = 428 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 131 VFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR 229 +FV +L + PE L + F+ FG +T+ I R Sbjct: 279 IFVANLLMDATPEQLNETFKGFGAITKDGIQVR 311 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 128 KVFVGSLPQGSKPEDLRKLFERFGVV 205 K+FVG+LP K + + F +FG + Sbjct: 166 KIFVGNLPTWIKKPEFEEFFRQFGPI 191 >At4g30250.1 68417.m04301 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 512 Score = 27.1 bits (57), Expect = 8.4 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +3 Query: 249 RQRNKRQQQFARFTTRHLTAASYPWSAVASKNAGSVGAVAVD 374 R+RN+ + + L A S+PW +V K+ + +A+D Sbjct: 168 RRRNEERLLYTNSRGVSLDARSHPWDSVRFKHPSTFDTLAMD 209 >At1g27650.1 68414.m03379 U2 snRNP auxiliary factor small subunit, putative Strong similarity to gb|Y18349 U2 snRNP auxiliary factor, small subunit from Oryza sativa. ESTs gb|AA586295 and gb|AA597332 come from this gene Length = 296 Score = 27.1 bits (57), Expect = 8.4 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 10/52 (19%) Frame = +2 Query: 182 LFERFGVVTECDIMNRCG----------FVHMQTEEQAAAAIRALHNSTFNG 307 LFE G E + +N C +V + E+QAAAA++AL ++G Sbjct: 85 LFEELGKFGEIESLNICDNLADHMIGNVYVQFKEEDQAAAALQALQGRFYSG 136 >At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 27.1 bits (57), Expect = 8.4 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR---CGFVHMQTEEQAAAAIRAL 286 T+V+VG+L +L F+ FGV+ + R F+ E A AI AL Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISAL 58 >At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 27.1 bits (57), Expect = 8.4 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = +2 Query: 125 TKVFVGSLPQGSKPEDLRKLFERFGVVTECDIMNR---CGFVHMQTEEQAAAAIRAL 286 T+V+VG+L +L F+ FGV+ + R F+ E A AI AL Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISAL 58 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,505,972 Number of Sequences: 28952 Number of extensions: 193181 Number of successful extensions: 824 Number of sequences better than 10.0: 124 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1053014392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -