BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_L09 (647 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23870.1 68414.m03011 glycosyl transferase family 20 protein ... 28 6.1 At4g01140.1 68417.m00152 expressed protein 27 8.1 >At1g23870.1 68414.m03011 glycosyl transferase family 20 protein / trehalose-phosphatase family protein contains Pfam profile: PF02358 trehalose-phosphatase Length = 867 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 100 LNSISLGREKKL*TTEYLPTLLKCDPATGEW 192 +NS + RE+K+ LP K D TG+W Sbjct: 51 VNSSNSSRERKIIVANMLPLQAKRDTETGQW 81 >At4g01140.1 68417.m00152 expressed protein Length = 306 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/24 (45%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +1 Query: 154 PTLLKCDP-ATGEWSNIKCIIYGE 222 P L+K DP A+ + S +KCI++G+ Sbjct: 157 PILIKFDPHASRDRSKVKCIVFGD 180 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,329,637 Number of Sequences: 28952 Number of extensions: 193094 Number of successful extensions: 294 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 285 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 294 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -