BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_J18 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_21312| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2956 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/64 (26%), Positives = 28/64 (43%) Frame = -2 Query: 598 DAKIXRRQTKMVNPSHLCRDLFMVPAYLXXXXXXXXXXXXXXFNVSEAKRGLVASVSVVR 419 D K RR+ + VNPS R FM+ +L ++ +RG+ SV + Sbjct: 2654 DDKESRRRRRAVNPSPRLRVRFMIKVFLKTEASFSVMNRTRHNILNMLRRGINVSVFHMM 2713 Query: 418 LVQN 407 + +N Sbjct: 2714 IGKN 2717 >SB_21312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 512 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 132 GKSITKTNWRLRNK*KISIAKRRVSPKISGNSFESLFI 245 G SI+ T WRLR K I I K+R + +S E + + Sbjct: 143 GVSIS-TLWRLRKKYDIDIGKKRKARTVSEQELEGIIL 179 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,490,636 Number of Sequences: 59808 Number of extensions: 318344 Number of successful extensions: 702 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -