BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_J07 (651 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15230.1 68418.m01784 gibberellin-regulated protein 4 (GASA4)... 28 4.7 At3g29300.1 68416.m03678 hypothetical protein 27 8.2 >At5g15230.1 68418.m01784 gibberellin-regulated protein 4 (GASA4) / gibberellin-responsive protein 4 identical to SP|P46690 Gibberellin-regulated protein 4 precursor {Arabidopsis thaliana} Length = 106 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +3 Query: 426 KTPKSSCECDPK-KYTSYHKNCGKLCNK 506 K + ECD + K T YHK C CNK Sbjct: 44 KRTQCPSECDRRCKKTQYHKACITFCNK 71 >At3g29300.1 68416.m03678 hypothetical protein Length = 213 Score = 27.5 bits (58), Expect = 8.2 Identities = 27/105 (25%), Positives = 48/105 (45%), Gaps = 2/105 (1%) Frame = +1 Query: 244 MNTKSTDKTAITLKLSFTSNDNASLVYDVLNVDXELKGSGVHREFQLKSNVLYIEFKSLX 423 ++T + T + +S TSNDN S ++ + +GV + K++ + + Sbjct: 47 VSTAARTTTTLNQAISTTSNDNTS-PSNINSSSPNPLYTGVIQT-PTKTHYNHEPYLQAS 104 Query: 424 LKRLR-VAVNAILKNILLITKTV-ENFATK*PAMPEHTPAPTPSR 552 L ++ VN + N + I+ + N AT P P TP +PSR Sbjct: 105 LDLIQETIVNDSVDNFIYISNPMYSNDATSKPTTPFETPESSPSR 149 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,151,360 Number of Sequences: 28952 Number of extensions: 223459 Number of successful extensions: 541 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -