BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_C12 (342 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52479| Best HMM Match : Laminin_B (HMM E-Value=2.2) 26 7.0 SB_14394| Best HMM Match : 7TMR-DISM_7TM (HMM E-Value=0.81) 26 7.0 >SB_52479| Best HMM Match : Laminin_B (HMM E-Value=2.2) Length = 465 Score = 26.2 bits (55), Expect = 7.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 191 FKNIIYLCEGVLMTSHSFTTIKVXYSXNIFLIIC 90 F N + + E +L+ + + +KV Y IF+I C Sbjct: 311 FTNYVMVIETILVLNMTGYNVKVVYITKIFIIHC 344 >SB_14394| Best HMM Match : 7TMR-DISM_7TM (HMM E-Value=0.81) Length = 282 Score = 26.2 bits (55), Expect = 7.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 191 FKNIIYLCEGVLMTSHSFTTIKVXYSXNIFLIIC 90 F N + + E +L+ + + +KV Y IF+I C Sbjct: 115 FTNYVMVIETILVLNMTGYNVKVVYITKIFIIHC 148 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,339,088 Number of Sequences: 59808 Number of extensions: 90403 Number of successful extensions: 151 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 498218920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -