BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_C08 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16839| Best HMM Match : zf-GRF (HMM E-Value=3.7e-15) 29 2.5 SB_46216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_39016| Best HMM Match : Extensin_2 (HMM E-Value=0.53) 29 4.3 SB_26078| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.45) 29 4.3 SB_2459| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_16839| Best HMM Match : zf-GRF (HMM E-Value=3.7e-15) Length = 333 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = -1 Query: 223 LLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSP 116 L++P K+F++ CV PG++ R P+ PS++ +P Sbjct: 207 LVAPITKYFIYGCVTPGAS-RTPTLVPSINGGNTTP 241 >SB_46216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 488 LPALMSFSTTRTHPKAIKQKFRMWKQIK 405 LP M T +T PK + Q FR +KQ++ Sbjct: 40 LPPNMRLQTPKTGPKGVIQDFRRYKQLE 67 >SB_39016| Best HMM Match : Extensin_2 (HMM E-Value=0.53) Length = 287 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 228 APSAGPMLPVAAVTRRTSRTVPHTYPSSV 314 AP+ P P AA R+VP T PSSV Sbjct: 112 APAPAPAAPSAAAAPAPVRSVPSTSPSSV 140 >SB_26078| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.45) Length = 671 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 184 VEPGSTPRCPSGTPSMSPQKGSPASQPYT 98 + P S P PS +P+ + GSP QP++ Sbjct: 77 LNPTSDPEIPSSSPNDNHLPGSPGEQPFS 105 >SB_2459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1741 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = -1 Query: 271 LVTAATGSMGPADGALLLSPSRKHFLFICVEPGSTPRCPSG 149 LV A T ++ PAD +L+ SPSR CV T C +G Sbjct: 751 LVFAWTYNVNPADASLIASPSRS-----CVHGNVTLTCTAG 786 >SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2834 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 252 PVAAVTRRTSRTVPHTYPSSVTLNSEPRCC*AQPTIQL 365 PVAA+ +T+++VPHT + T P C Q T L Sbjct: 2027 PVAALATQTTQSVPHTMGNPTT--PRPPSCLTQQTSTL 2062 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,700,216 Number of Sequences: 59808 Number of extensions: 445426 Number of successful extensions: 1247 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1218 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -