BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_B14 (537 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7580| Best HMM Match : Topoisom_bac (HMM E-Value=0) 29 1.8 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 >SB_7580| Best HMM Match : Topoisom_bac (HMM E-Value=0) Length = 856 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 113 CXVSKADXSFSRXF*ELRNXFT--RGCPFCGATC*PIAVL 226 C SK D F++ L N T RGCPFC P+ L Sbjct: 771 CGSSKLDVDFNKANSPLPNNLTQHRGCPFCDPILVPLVRL 810 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = -3 Query: 415 TRKLAC*HHCILLYYLSLSDKRQHLADSSVAKQ 317 TR+LA +H LL+ + +KR+ LA S+ AKQ Sbjct: 122 TRQLANVYHLNLLWRRQVGEKRRKLATSAKAKQ 154 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,173,440 Number of Sequences: 59808 Number of extensions: 262001 Number of successful extensions: 511 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -