BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_I23 (353 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24715| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.8 SB_6868| Best HMM Match : DUF116 (HMM E-Value=0.65) 26 7.7 >SB_24715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 26.6 bits (56), Expect = 5.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 178 CPSPVTPLSVISNSVSCAH 122 CPSP TP S SNS S A+ Sbjct: 40 CPSPTTPPSSRSNSSSSAY 58 >SB_6868| Best HMM Match : DUF116 (HMM E-Value=0.65) Length = 246 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +2 Query: 65 RANWPKS*NKTDPFLSWVRMRTGNTIRYNAKRRHWRRTKL 184 +A WP D + WV++ + N +RR R +L Sbjct: 142 KAEWPTKQEVVDTLMDWVQLLANASRELNIRRREALRYEL 181 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,002,711 Number of Sequences: 59808 Number of extensions: 113047 Number of successful extensions: 225 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 225 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 548040812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -