BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP03_F_L21
(889 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor prot... 29 0.057
>S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor
protein.
Length = 85
Score = 29.1 bits (62), Expect = 0.057
Identities = 17/39 (43%), Positives = 23/39 (58%)
Frame = +2
Query: 509 ISVSPLLDLDISYNLITFNVLQLSLILSKYKKISTHNTH 625
+ VS L+ L ISY LI FN+L +S +K I T +H
Sbjct: 19 VIVSSLIIL-ISYALILFNILHMSSAEGWFKAIGTCGSH 56
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 163,627
Number of Sequences: 438
Number of extensions: 2611
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28662543
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -