BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_N16 (838 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 25 0.74 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 23 3.0 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 5.2 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 9.1 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 25.0 bits (52), Expect = 0.74 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -3 Query: 761 EIGVNVAIXRRRIR-SPQLTPLGAAP 687 E+G N+ +R R SPQL+P+ + P Sbjct: 461 ELGTNIYTSSKRQRTSPQLSPMSSLP 486 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 23.0 bits (47), Expect = 3.0 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +2 Query: 296 LPEWMSAPHSTGTSI 340 +P W++ PHS G ++ Sbjct: 4 VPGWLTPPHSLGNTV 18 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.2 bits (45), Expect = 5.2 Identities = 11/45 (24%), Positives = 18/45 (40%) Frame = -3 Query: 635 QQLKYQPSMSHGSCNRALGILLQQFPLVVDLLIPSCGSSNDMLQY 501 Q + + MSH G P ++ L+P+ S D+ Y Sbjct: 344 QAMLHHNPMSHHLKQEPSGFTSSNHPFSINRLLPTAESKADIKMY 388 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +2 Query: 614 MAGILVAGWDKKKGAQIYSIPIGGMVQRQAVSIGGS 721 +A V D +Y +P +++QA+ GG+ Sbjct: 492 VASSKVGSADHSARINVYGLPFVRSMEKQAIVAGGT 527 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,888 Number of Sequences: 336 Number of extensions: 4455 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23036718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -