BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_N15 (902 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_46013| Best HMM Match : DUF1129 (HMM E-Value=0.23) 31 1.7 SB_40906| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_377| Best HMM Match : IQ (HMM E-Value=0.0002) 30 2.2 SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) 30 2.9 SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_3143| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) 26 4.7 SB_33446| Best HMM Match : 7tm_1 (HMM E-Value=6.7e-26) 29 5.1 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_15491| Best HMM Match : zf-C3HC4 (HMM E-Value=0.079) 29 5.1 SB_5480| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_58666| Best HMM Match : Vps16_C (HMM E-Value=6.4e-37) 29 6.8 SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) 29 6.8 SB_14436| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_42040| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 32.3 bits (70), Expect = 0.55 Identities = 28/103 (27%), Positives = 40/103 (38%) Frame = +1 Query: 310 NHKVPHDLRNVENPSQRPEHRDPQDYSALNERKSQDKHTENLIPNLTNSHKSYGYTGIDK 489 N K P + ++ NP+ R P N + T N P S Y + K Sbjct: 955 NPKSPSEAPSLNNPNPRSSCTTPPSSDTTNSSSAGPSATNNASP----SSSPYVASAPGK 1010 Query: 490 DESIVSQDKVAFTNDNGNLYQSKESHSENSGTSTQDTVXKIIY 618 D S S + ND+ Y S ES S+ + +DT +IY Sbjct: 1011 DSS-ASANSWYLLNDSRVSYASFESFSDITKRFPKDTPYVLIY 1052 >SB_46013| Best HMM Match : DUF1129 (HMM E-Value=0.23) Length = 553 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = +1 Query: 388 SALNERKSQDKHTENLIPNLTNSHKSYGYTGIDKDESIVSQDKVAFTNDNGNLYQSKESH 567 +++N+ + +N I + NS + D D SI D + NDN ++Y + S Sbjct: 289 NSINDNDNSINDNDNSIYDNDNSINDNDNSINDNDNSINDNDNSIYDNDNSSIYDNDNSI 348 Query: 568 SENSGT 585 +N + Sbjct: 349 YDNDNS 354 >SB_40906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.7 bits (66), Expect = 1.7 Identities = 23/120 (19%), Positives = 53/120 (44%), Gaps = 1/120 (0%) Frame = +1 Query: 355 QRPEHRDPQDYSALNERKSQDKHTENLIPNLT-NSHKSYGYTGIDKDESIVSQDKVAFTN 531 ++ E D ++E + +D+ T N P L N KSY I E ++ ++ + + Sbjct: 28 RKREKSKGDDDGNVDENEPKDEETANQTPTLKDNDEKSYYKVDIPSSEQRITVEERSDDS 87 Query: 532 DNGNLYQSKESHSENSGTSTQDTVXKIIYVQTDGLQDNQLYQVAGSSGDSIIMSRAQTNK 711 G+L KES+ G + + + Y + ++ + +S +++ +A+ ++ Sbjct: 88 TRGHLGSPKESN--EFGIPSYAQLGRTAYSLESKYKHSEFLETRRTSSIAVLRQKAKEHE 145 >SB_377| Best HMM Match : IQ (HMM E-Value=0.0002) Length = 1376 Score = 30.3 bits (65), Expect = 2.2 Identities = 22/87 (25%), Positives = 38/87 (43%) Frame = +1 Query: 319 VPHDLRNVENPSQRPEHRDPQDYSALNERKSQDKHTENLIPNLTNSHKSYGYTGIDKDES 498 V D + V ++ E D L+ + SQ + + N H S+ G+D E+ Sbjct: 694 VKTDDQKVTGLQKKDEIGSELDNCELSSKSSQPESEQVRESKTHNEHVSHAPDGLDTQET 753 Query: 499 IVSQDKVAFTNDNGNLYQSKESHSENS 579 + S+D+ + T KE +SE+S Sbjct: 754 VGSKDEDSITERKKT--DQKEGNSESS 778 >SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) Length = 193 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = +1 Query: 373 DPQDYSALNERKSQDKHTENLIPNLTNSHKSYGYTGIDKDESIVSQDKVAFTNDNGNLYQ 552 DP + ++ K + + N+ ++ + GYT IDK ++ DK FT + G Sbjct: 106 DPVIDAPFDKYKGVEMNAVNIKSDIDEQRRQKGYTFIDK--ALTLADKSLFTEEAGMRED 163 Query: 553 S-KESHSENSGTSTQD 597 S K + S + G T+D Sbjct: 164 SLKVAVSMSDGIQTKD 179 >SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +1 Query: 295 IIERRNHKVPHDLRNVE---NPSQRPEHRDPQDYSALNERKSQDKHTENLIP 441 +I+ HK P D +PS +H P DYS Q +T++++P Sbjct: 891 LIDELTHKAPLDYSRAPRYGDPSINTQHMVPLDYSQAPRYCDQSMNTQHMVP 942 >SB_3143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 29.5 bits (63), Expect = 3.9 Identities = 24/108 (22%), Positives = 47/108 (43%), Gaps = 7/108 (6%) Frame = +1 Query: 343 ENPSQRPEHRDPQDYSALNERKSQDKHTENLIPNLTNSHKSYGYTGIDKDESIVSQDKVA 522 E+ S H + + ++E+K ++K ENL+ KSY + ++ +S + + Sbjct: 170 EDNSLNNSHSENDSKNRVSEKKYEEKTGENLVTETYQEQKSYQNSDYERQKSDRERTEAE 229 Query: 523 FTN-DNGNLYQSKESHSENS------GTSTQDTVXKIIYVQTDGLQDN 645 + + N +SKE+ + +S ST + Y D + DN Sbjct: 230 SSQITSRNTDESKETFAGSSRLPYDLSHSTAGSADLYAYACADPVDDN 277 >SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) Length = 405 Score = 25.8 bits (54), Expect(2) = 4.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 550 QSKESHSENSGTSTQD 597 QS E H+EN G S QD Sbjct: 8 QSTEKHTENEGNSNQD 23 Score = 21.8 bits (44), Expect(2) = 4.7 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 397 NERKSQDKHTEN 432 NE +S +KHTEN Sbjct: 5 NEGQSTEKHTEN 16 >SB_33446| Best HMM Match : 7tm_1 (HMM E-Value=6.7e-26) Length = 291 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 70 MAWIVQLILACLFSLNVSCHFYRINNAARIPETPFI-NSDPVNYLQKL 210 M W+ ++AC F L V+ + Y + +T FI NS P+ +K+ Sbjct: 158 MLWLATALIACTFPLWVTSYSYLYIFKSAHAQTQFIVNSSPIEERRKI 205 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/81 (23%), Positives = 41/81 (50%), Gaps = 5/81 (6%) Frame = +1 Query: 289 DLIIERRNHKVPHDLRNVENPS-QRPEHRDP----QDYSALNERKSQDKHTENLIPNLTN 453 +++ E ++ KV +++E +R +H++ +D + ER+ +D EN+ N+ N Sbjct: 954 EMVDEEQDRKVKDAEKDLEEVKLERRKHQEELETLKDKTLKVERELRDSQQENIKMNIEN 1013 Query: 454 SHKSYGYTGIDKDESIVSQDK 516 S S + ++ I +DK Sbjct: 1014 SKLSRKVSSLESSVEIFEKDK 1034 >SB_15491| Best HMM Match : zf-C3HC4 (HMM E-Value=0.079) Length = 689 Score = 29.1 bits (62), Expect = 5.1 Identities = 24/97 (24%), Positives = 41/97 (42%) Frame = +1 Query: 307 RNHKVPHDLRNVENPSQRPEHRDPQDYSALNERKSQDKHTENLIPNLTNSHKSYGYTGID 486 R+H + H+LRN+ R P D++ + + + H S+ Y Y D Sbjct: 409 RHHPLGHELRNIYE-------RSPLDWNPFDHARRRRYHR-------APSYYDYDYVS-D 453 Query: 487 KDESIVSQDKVAFTNDNGNLYQSKESHSENSGTSTQD 597 + + V D+ + N N N Y+S + S+ S D Sbjct: 454 ESDDWVPFDRNSRRNINNNNYESDDDDSDTDMVSDLD 490 >SB_5480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 550 QSKESHSENSGTSTQDTVXKIIYVQTDGLQDN 645 QS+ H E+SG ST+D++ ++ T G + N Sbjct: 277 QSENGHGESSGASTEDSMQHVLQDVTHGSKVN 308 >SB_58666| Best HMM Match : Vps16_C (HMM E-Value=6.4e-37) Length = 259 Score = 28.7 bits (61), Expect = 6.8 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 2/80 (2%) Frame = +1 Query: 382 DYSALNERKSQDKH--TENLIPNLTNSHKSYGYTGIDKDESIVSQDKVAFTNDNGNLYQS 555 D + ++ RKS +K E+ + L+++ +Y G + + ++++++ +D L Sbjct: 50 DLANMSVRKSINKELDVESKMDCLSDAKMNYTKAG-NVIYTKITEEQMKLLDDQSRL--E 106 Query: 556 KESHSENSGTSTQDTVXKII 615 KE H E TS DT+ K I Sbjct: 107 KEQHQEFKNTSLSDTIEKCI 126 >SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) Length = 2440 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 2/76 (2%) Frame = +1 Query: 277 PDLGDLIIERRNHKVPHDLRNVENPSQRPEHRDP--QDYSALNERKSQDKHTENLIPNLT 450 P LG +++ K R+ P + H+DP + + +E + + +LT Sbjct: 187 PALGKRLMDLSKAKAQ---RSSSIPERLSTHQDPGVDEGKSRSETELNSARKNSSEVHLT 243 Query: 451 NSHKSYGYTGIDKDES 498 + H+S TG+DK+E+ Sbjct: 244 DLHRSQSLTGLDKNEA 259 >SB_14436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 765 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 343 ENPSQRPEHRDPQDYSALNERKSQDKHTENLIPNLTN 453 ++ +Q P HR PQ+YS ++S+ + + P L N Sbjct: 85 DSRNQHPNHRIPQNYSLRTIKRSEIRGSTGSPPTLAN 121 >SB_42040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = +1 Query: 271 NIPDLGDLIIERRNHKVPHDLRNVENPSQRPEHRDPQDYSALNE---RKSQDKHTENLIP 441 N PD + + E N+K H + E+ + +P+H D + Y N+ R ++ H N Sbjct: 192 NKPDNLNKMSEHLNNKPDHLNKMSEHLNNKPDHLDNKPYHLNNKPDHRNNKPDHLNNKPE 251 Query: 442 NLTN 453 +L N Sbjct: 252 HLNN 255 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,618,257 Number of Sequences: 59808 Number of extensions: 508012 Number of successful extensions: 1384 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1370 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2597949818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -