BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_N13 (905 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49946| Best HMM Match : No HMM Matches (HMM E-Value=.) 111 7e-25 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_698| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00037) 48 8e-06 SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) 48 1e-05 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 47 2e-05 SB_39560| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00055) 44 1e-04 SB_23054| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_23934| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 42 0.001 SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) 41 0.002 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 40 0.004 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 38 0.008 SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) 36 0.045 SB_39138| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) 34 0.18 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 33 0.24 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 33 0.24 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 33 0.24 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 33 0.24 SB_6618| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_41318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 32 0.73 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 32 0.73 SB_16806| Best HMM Match : CUE (HMM E-Value=1e-07) 32 0.73 SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 31 0.97 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 31 0.97 SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 30 2.2 SB_24433| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_24608| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-14) 30 3.0 SB_20928| Best HMM Match : NHL (HMM E-Value=0) 30 3.0 SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) 30 3.0 SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) 30 3.0 SB_13966| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 29 5.2 SB_45378| Best HMM Match : DUF843 (HMM E-Value=4.7) 29 6.8 SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_32455| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_43060| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_34605| Best HMM Match : APG6 (HMM E-Value=0.94) 28 9.0 SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) 28 9.0 >SB_49946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 111 bits (267), Expect = 7e-25 Identities = 60/124 (48%), Positives = 73/124 (58%), Gaps = 6/124 (4%) Frame = +3 Query: 171 MAGYFEEMGWRELGDGEQPNHLLHFARFLIDSGLDRTGAAEWPSLPPPASKEAVQKLQDV 350 MA YF+E + +PN LL A +G D G+ PPASKEAVQ L V Sbjct: 1 MASYFDEHAATDRAS--EPNFLLELA----SAGFDDLGS-------PPASKEAVQALPAV 47 Query: 351 VI------ENQKKGCPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFCRHEMP 512 + E CPICL + E GE K+MPC+H+FHP CIL WL+KTNSCP CRHE+P Sbjct: 48 EVTDKHLKELSTSSCPICLGDYEKGESTKQMPCDHLFHPGCILPWLEKTNSCPVCRHELP 107 Query: 513 TDDE 524 TD+E Sbjct: 108 TDNE 111 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 49.6 bits (113), Expect = 3e-06 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFHPRCILTWL-DKTNSCPFCRHEMPT 515 C ICL + G+K++ +PC+H +H +C+ WL + +CP C+ + T Sbjct: 301 CAICLDEYKEGDKLRILPCDHAYHCKCVDPWLTEGKRTCPVCKRPVET 348 >SB_698| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00037) Length = 303 Score = 48.4 bits (110), Expect = 8e-06 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 321 KEAVQKLQDVVI-ENQKKGCPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTN-SCP 491 K + LQ V + E C IC++ G+ +K +PC H FH CI TWL T+ CP Sbjct: 238 KHIIDGLQCVTVNEGIDDVCLICMEEYAVGDSMKYLPCRHNFHSACIRTWLTYTSCKCP 296 >SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) Length = 558 Score = 47.6 bits (108), Expect = 1e-05 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +3 Query: 351 VIENQKKGCPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFC 497 V E K C ICL+ + G+ ++ +PC H FH C+ WL +CP C Sbjct: 207 VTEKNPK-CVICLEGFKNGQDLRIVPCRHEFHKECVDPWLLSNFTCPLC 254 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 46.8 bits (106), Expect = 2e-05 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +3 Query: 363 QKKGCPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFCRHEMPTDDE 524 + K CPICL+ + + C H + C+ WL+ +CP CR +D+ Sbjct: 258 ESKSCPICLEEFTPETPTRLLVCGHKYCEPCLSRWLENNTTCPICRKPTSRNDD 311 >SB_39560| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00055) Length = 545 Score = 44.4 bits (100), Expect = 1e-04 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFHPRCILTWL 470 C +C+ + EK++K+PCNH FH +CI WL Sbjct: 361 CVVCMMDYTNREKLRKLPCNHDFHSKCIDRWL 392 >SB_23054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCP 491 C +CL + V+K+ C H+FH CI +WL + CP Sbjct: 212 CGVCLSAYHPLQYVRKLQCRHVFHRDCIDSWLATQSICP 250 >SB_23934| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 617 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 5/47 (10%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFHPRCILTWL--DKT---NSCPFCR 500 C ICL + G + +PC H FH CI WL D T + CP CR Sbjct: 560 CVICLDEFKPGCTLLGLPCGHSFHQHCIEVWLAGDNTAPHHCCPNCR 606 >SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) Length = 358 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +3 Query: 357 ENQKKGCPICLKNLEAGEKVKKMPCNHIFHPRCILTWL 470 +N C +CL + E + V+ +PC H +H RCI WL Sbjct: 287 QNDDARCVVCLVDFEEKQLVRTLPCLHEYHTRCIDKWL 324 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/61 (29%), Positives = 32/61 (52%) Frame = +3 Query: 318 SKEAVQKLQDVVIENQKKGCPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFC 497 +K+A ++ + V+E + C+ E + + C+H F C+ +WL K N+CP C Sbjct: 350 TKKAEEEARKSVVEEMEDEFS-CIVCQELFIRATTLTCSHSFCEYCLQSWLRKRNTCPIC 408 Query: 498 R 500 R Sbjct: 409 R 409 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 378 PICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFCRHEMPTD 518 P C ++ +++ C HIF CI W D+ +CP CR + D Sbjct: 484 PTC--QVKLAKQIMLRTCKHIFCEDCISLWFDREQTCPMCRARVAGD 528 >SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) Length = 320 Score = 35.9 bits (79), Expect = 0.045 Identities = 19/65 (29%), Positives = 33/65 (50%) Frame = +3 Query: 324 EAVQKLQDVVIENQKKGCPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFCRH 503 E + LQ++ + + CP+CL+ +A V+ +PC H+F CI ++ C CR Sbjct: 54 EEEEVLQNIFELDYQPDCPVCLQ--QASYPVR-LPCGHMFCFLCIKGVALRSRKCAICRQ 110 Query: 504 EMPTD 518 + D Sbjct: 111 PISPD 115 >SB_39138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 624 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 3/61 (4%) Frame = +3 Query: 345 DVVIENQKKGCPICLKNLEAGEKVKKMPCN---HIFHPRCILTWLDKTNSCPFCRHEMPT 515 DV + C +CLK + A + ++PC+ IFH +C+ + + C FC T Sbjct: 215 DVSLNPGPTNCAVCLKGIRARQP--RLPCHLCEQIFHLKCLGAEYELSRCCQFCAVRSTT 272 Query: 516 D 518 + Sbjct: 273 E 273 >SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) Length = 310 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFCRHEM-PTD 518 C IC LE + PC H + C+L WL N+CP R + P+D Sbjct: 18 CCICRDVLE---EPLMAPCEHSYCSACVLGWLTHYNTCPEDRQSLWPSD 63 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/64 (26%), Positives = 31/64 (48%) Frame = +3 Query: 330 VQKLQDVVIENQKKGCPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFCRHEM 509 +++ D V ++ K C IC LE C H+F +C++ W+ + +CP ++ Sbjct: 44 IERFLDPVEDDFK--CGICFGVLE---DPLVTTCGHVFCSQCLVHWIAENGTCPLTCEQL 98 Query: 510 PTDD 521 DD Sbjct: 99 AIDD 102 >SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = +3 Query: 426 PCNHIFHPRCILTWLDKT---NSCPFCR 500 PC+H F CI WLD+T + CP C+ Sbjct: 174 PCDHYFCVLCICEWLDQTYNKSGCPVCK 201 >SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 262 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = +3 Query: 426 PCNHIFHPRCILTWLDKT---NSCPFCR 500 PC+H F CI WLD+T + CP C+ Sbjct: 48 PCDHYFCVLCICEWLDQTYNKSGCPVCK 75 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = +3 Query: 426 PCNHIFHPRCILTWLDKT---NSCPFCR 500 PC+H F CI WLD+T + CP C+ Sbjct: 174 PCDHYFCVLCICEWLDQTYNKSGCPVCK 201 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFHPRCILTWL-DKTNSCPFCRHEMPT 515 C ICL++ G +V + C+H H C + + + +CP CRH + T Sbjct: 1985 CCICLEDAFTGCQV--LACSHKVHRDCAVAMVRNGVRNCPICRHPLYT 2030 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = +3 Query: 426 PCNHIFHPRCILTWLDKT---NSCPFCR 500 PC+H F CI WLD+T + CP C+ Sbjct: 174 PCDHYFCVLCICEWLDQTYNKSGCPVCK 201 >SB_6618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 32.7 bits (71), Expect = 0.42 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 345 DVVIENQKKGCPICLKNLEAGEKVKKMPCNHIFHPRCILTW 467 D + N + CP+CL +L + C H+F CIL W Sbjct: 93 DATMSNSAQ-CPVCLMSLSEQKLGTPNSCMHVFCLECILEW 132 >SB_41318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.55 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 9/77 (11%) Frame = +3 Query: 312 PASKEAVQKLQDVVIENQKKGCPICLKNLEAGEK----VKKMPC-NHIFHPRCILTWLD- 473 PA+K+ + +D+ ++ C IC + + ++PC + H +C W+ Sbjct: 9 PATKKFCELAKDIY-NSEGLACVICQDDRVTSNSSLTLLDRLPCCGQVCHQQCFWKWIHF 67 Query: 474 -KTN--SCPFCRHEMPT 515 +T +CP CRH P+ Sbjct: 68 HRTEDITCPHCRHAFPS 84 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFCR 500 CPICL+ + E ++ C H F CI + CP CR Sbjct: 678 CPICLETITYPETLQG--CGHTFCRPCITEASKSSKLCPTCR 717 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFCR 500 CPICL+ + E ++ C H F CI + CP CR Sbjct: 753 CPICLETITYPETLQG--CGHTFCRPCITEASKSSKLCPTCR 792 >SB_16806| Best HMM Match : CUE (HMM E-Value=1e-07) Length = 322 Score = 31.9 bits (69), Expect = 0.73 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFH 446 C IC N+ K +K+PCNH+FH Sbjct: 91 CAICWDNMG---KARKLPCNHLFH 111 >SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 346 Score = 31.5 bits (68), Expect = 0.97 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDK--TNSCPFCR-HEMPTD 518 C IC+ LE C H F C+ TWL + SCP CR H + D Sbjct: 18 CNICVGVLE---NAITTICGHSFCESCLETWLSRPEVQSCPSCRSHVLSLD 65 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 31.5 bits (68), Expect = 0.97 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 426 PCNHIFHPRCILTWLDKTNSCPFCRHEM 509 PC H+F C+ LD CP CR + Sbjct: 393 PCGHVFCRACLNRSLDHRPGCPICRSSL 420 >SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1716 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 429 CNHIFHPRCILTWLDKTNSCPFCRHEM 509 C H F CI++WL + CP C E+ Sbjct: 1382 CLHSFCRSCIVSWLQASYHCPVCDTEV 1408 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/65 (24%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +3 Query: 315 ASKEAVQKLQDVVIENQKKGCPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTN---S 485 +++ + +L V+ + CPICL L+ + C H+F C+ ++ Sbjct: 45 STERLINQLLQVLSSGVSEECPICLDPLDDPSITR---CAHVFCTGCLTDVIENEGLAPR 101 Query: 486 CPFCR 500 CP CR Sbjct: 102 CPMCR 106 >SB_24433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 486 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFCRHEMPT 515 CPIC + V+ +PC H+ CI L C FC+ + T Sbjct: 430 CPICCAMRIS---VRFLPCRHVSCRSCITRHLMNNKECFFCKEVVDT 473 >SB_24608| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-14) Length = 390 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 7/47 (14%) Frame = +3 Query: 381 ICLKNLEAGEKVKKMPCN-----HIFHPRCILTWLDKT--NSCPFCR 500 IC AGE+ PC+ H C+LTW K N+C CR Sbjct: 201 ICRICHSAGEEPLVTPCHCSGSAKFVHATCLLTWFKKAVKNTCELCR 247 >SB_20928| Best HMM Match : NHL (HMM E-Value=0) Length = 795 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 6/53 (11%) Frame = +3 Query: 381 ICLKNLEAGEKVKKMPCNHIFHPRCILTWLDK------TNSCPFCRHEMPTDD 521 +C K + A E K +PC H F +C+ L + +CP C + P D Sbjct: 14 VCPKCMNAYENPKVLPCLHTFCSQCLSEELHRDCEGRLNVTCPKCLRDFPLRD 66 >SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 29.9 bits (64), Expect = 3.0 Identities = 25/76 (32%), Positives = 32/76 (42%), Gaps = 3/76 (3%) Frame = +3 Query: 282 GAAEWPSLPPPASKEAVQKLQDVVIENQKKGCPICLKNLEAGEKVKKMPCNHIFHPRCIL 461 GAA S P AS + D N C ICL A + V M C H+F C+ Sbjct: 35 GAASSSSSEPTASHNPSE---DPNSANANFECNICLDT--ARDAVISM-CGHLFCWPCLH 88 Query: 462 TWLD---KTNSCPFCR 500 WL+ + CP C+ Sbjct: 89 RWLETRPNRSMCPVCK 104 >SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) Length = 671 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +3 Query: 408 EKVKK---MPCNHIFHPRCILTWLDKTNSCPFCRHEMPTD 518 EKVK+ P H+F C+ WL CP CR + D Sbjct: 108 EKVKEPVVCPNQHVFCSPCLDLWLRTNRYCPTCRTPINQD 147 >SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) Length = 499 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +3 Query: 429 CNHIFHPRCILTWLDKTNSCPFCRHEMPTDD 521 C+ IF CI WL +C CR + D Sbjct: 347 CDQIFCSGCITAWLRNAGACSSCRSVLEVSD 377 >SB_13966| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFCRHE 506 C +C + L+ C H FH C + + N CP C E Sbjct: 74 CNLCSRPLDL--PAVHFLCLHSFHQPCFEGYAENDNECPICTPE 115 >SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +3 Query: 357 ENQKKGCPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNSCPFCRHEM 509 ENQ C ICL+N V + C H+ R T + + CP CR ++ Sbjct: 532 ENQGTQCVICLEN---QRNVVLLNCGHVCSCR---TCAQQIHQCPVCRGDI 576 >SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 306 Score = 29.1 bits (62), Expect = 5.2 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 8/57 (14%) Frame = +3 Query: 375 CPICLKNLEAGEKVKKMPCNHIFHPRCILTWLD---KTN-----SCPFCRHEMPTDD 521 C IC + LE + PC H F C+ TW++ + N SCP CR ++ D Sbjct: 18 CGICAEVLE---RAVLTPCGHSFCGVCLETWMNAKLEENEKCPASCPSCRADLYQGD 71 >SB_45378| Best HMM Match : DUF843 (HMM E-Value=4.7) Length = 228 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +2 Query: 251 ISHRFWLRSNWCSGVAKLTSACIERGSTKITRCCNRKSKERLPNMFEELR 400 + HR +LR W + + + T C+ G +CC RK + L ++ ELR Sbjct: 33 VEHRKYLRFKWKNTLFQYT--CLPNG----LKCCPRKFTKLLKPVYSELR 76 >SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1503 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 330 VQKLQDVVIENQKKGCPICLKNLEAGEKVKKM 425 ++KL D ++N GCP+C + EA ++K + Sbjct: 329 IKKLTDPSVKND--GCPLCHRRFEANAQIKTL 358 >SB_32455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 749 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/59 (30%), Positives = 34/59 (57%) Frame = +1 Query: 490 RFVDMRCLLMTKIMKPTRKQRNELNSHKMILMHYTIQCLVSSFIIINFLGLLVISGDIN 666 R+ + +L+ + PT NE ++++L+H +Q V SF+ + GL++I+GD N Sbjct: 130 RYPSVSMVLVAAVYHPTSCGANE---NQVLLLH--LQSNVESFLRQHPEGLILIAGDFN 183 >SB_43060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 372 GCPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKT 479 G P+ + +E K C H FH C+ ++D T Sbjct: 85 GSPMLFELIEDSHCFTKTECYHYFHCSCLARYIDHT 120 >SB_34605| Best HMM Match : APG6 (HMM E-Value=0.94) Length = 1047 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 315 ASKEAVQKLQDVVIENQKKGCPICLKNLEAGEKVKKMPCN 434 ASK A + VV +N+ K IC + E +KV++MP N Sbjct: 449 ASKLADTMIHYVVDQNRDKNRGICRQYDEVSDKVQEMPDN 488 >SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) Length = 877 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = +3 Query: 363 QKKGCPICLKNLEAGEKVKKMPCNHIFHPRCILTWLDKTNS----CPFCRHEMPTD 518 Q+ C IC L + +PC H + RCI + S CP C E+P D Sbjct: 141 QQLACGICHALLR---DARVLPCLHTYCRRCIEDIILHRQSVRAHCPSCNREIPLD 193 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,237,670 Number of Sequences: 59808 Number of extensions: 463829 Number of successful extensions: 1157 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 1072 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1155 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2609867019 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -