BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_N10 (847 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12833| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_17106| Best HMM Match : FYVE (HMM E-Value=5e-17) 28 8.3 >SB_12833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = -3 Query: 263 KCADIYICALDLALNFRSAVPEALS*VEWATRRPPLATPQRRSRRPSAL 117 KC +I L+ ALN +S++ E ++ V + P + T Q+ RP+ L Sbjct: 284 KCVNILEKFLETALNAKSSLSEFINVVVVHIKIPTIVTEQQEPVRPATL 332 >SB_17106| Best HMM Match : FYVE (HMM E-Value=5e-17) Length = 289 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 371 VHHSTRVCGARHGRRSTAALLSLPYCWLVYLS 466 V + CG H R TA SL Y WL+ +S Sbjct: 32 VQFTAAACGEAHMNRVTANCFSLEYEWLLSIS 63 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,548,521 Number of Sequences: 59808 Number of extensions: 498796 Number of successful extensions: 1327 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1323 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -