BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_N08 (874 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 206 2e-53 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 145 5e-35 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 98 9e-21 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 9e-21 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 77 2e-14 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 54 2e-07 SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) 52 5e-07 SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 45 9e-05 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 45 9e-05 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 45 9e-05 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 45 9e-05 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 45 9e-05 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 45 9e-05 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 45 9e-05 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 45 9e-05 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 45 9e-05 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 45 9e-05 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 45 9e-05 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 45 9e-05 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 45 9e-05 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 45 9e-05 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 45 9e-05 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 45 9e-05 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 45 9e-05 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 45 9e-05 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 45 9e-05 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 45 9e-05 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 45 9e-05 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 45 9e-05 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 45 9e-05 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 45 9e-05 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 45 9e-05 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 45 9e-05 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 45 9e-05 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 45 9e-05 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 45 9e-05 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 45 9e-05 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 45 9e-05 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 45 9e-05 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 45 9e-05 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 45 9e-05 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 45 9e-05 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 45 9e-05 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 45 9e-05 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 45 9e-05 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 45 9e-05 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 45 9e-05 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 45 9e-05 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 45 9e-05 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 45 9e-05 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 45 9e-05 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 45 9e-05 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 45 9e-05 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 45 9e-05 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 45 9e-05 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 45 9e-05 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 45 9e-05 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 9e-05 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 45 9e-05 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 45 9e-05 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 45 9e-05 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 45 9e-05 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 45 9e-05 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 45 9e-05 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 45 9e-05 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 206 bits (503), Expect = 2e-53 Identities = 98/122 (80%), Positives = 101/122 (82%) Frame = +2 Query: 413 KEHVSKRPAKGQEP*KGRVAGVFXXXXXXXTSITKIDAQVRGGETRQDYKDTRRFPLEAP 592 ++ SKRP + P R F TSITKIDAQVRGGETRQDYKDTRRFPLEAP Sbjct: 96 EQKASKRPGTVKRPRCWR----FSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAP 151 Query: 593 SCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTXPPFSPTAAPY 772 SCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCT PPFSPTAAPY Sbjct: 152 SCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPPFSPTAAPY 211 Query: 773 PV 778 PV Sbjct: 212 PV 213 Score = 83.8 bits (198), Expect = 2e-16 Identities = 61/144 (42%), Positives = 76/144 (52%), Gaps = 6/144 (4%) Frame = +1 Query: 382 VIHRIRGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLXEHHK---NRRSSQRWRNPT 552 +I+ +GITQERTCEQKASKRPGTVKRPRCWRFSIGSAPL K R + ++ Sbjct: 82 LIYLNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYK 141 Query: 553 GL*RYQAFPPGSSLVRSP--VP-TLPLTGYLSAFLPSGSVALSHSSRCRYLSSV*VVRSK 723 R+ P +L+ P +P T P A+ + A+ S RCR + V Sbjct: 142 DTRRFPLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAV--- 198 Query: 724 LGCVHXPPVQPDRCALSGTIVLSP 795 C + PP P TIVLSP Sbjct: 199 --CTN-PPFSPTAAPYPVTIVLSP 219 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 145 bits (351), Expect = 5e-35 Identities = 73/111 (65%), Positives = 79/111 (71%) Frame = +2 Query: 413 KEHVSKRPAKGQEP*KGRVAGVFXXXXXXXTSITKIDAQVRGGETRQDYKDTRRFPLEAP 592 ++ SKRP + P R F TSITKIDAQVRGGETRQDYKDTRRFPLEAP Sbjct: 125 EQKASKRPGTVKRPRCWR----FSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAP 180 Query: 593 SCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTXP 745 SCALLFRPCRLPDTCPPFSLREAWRFLIAHAV I ++F S + P Sbjct: 181 SCALLFRPCRLPDTCPPFSLREAWRFLIAHAVAIRTAKKTFQGSTSSMAAP 231 Score = 79.0 bits (186), Expect = 5e-15 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 397 RGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPL 501 +GITQERTCEQKASKRPGTVKRPRCWRFSIGSAPL Sbjct: 116 QGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPL 150 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 97.9 bits (233), Expect = 9e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 243 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 374 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 97.9 bits (233), Expect = 9e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 243 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 374 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 84.2 bits (199), Expect = 1e-16 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 519 IFVMLVQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 400 +FV+ +GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 548 LFVLRGKGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 587 Score = 54.8 bits (126), Expect = 9e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -3 Query: 464 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 330 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 570 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 610 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 83.0 bits (196), Expect = 3e-16 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 511 DARXGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 D GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 55 DLNSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 92 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 80 WPFAHMF----FPALSPDSVDNRITAF 102 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 82.2 bits (194), Expect = 5e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 501 QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 400 QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 22 QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 55 Score = 54.8 bits (126), Expect = 9e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -3 Query: 464 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 330 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 38 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 78 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 93 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 126 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 114 WPFAHMF----FPALSPDSVDNRITAF 136 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 9e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 81.0 bits (191), Expect = 1e-15 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 501 QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 400 +GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 405 EGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 438 Score = 54.8 bits (126), Expect = 9e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -3 Query: 464 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 330 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 421 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 461 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 80.6 bits (190), Expect = 2e-15 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 501 QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 400 +GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 758 RGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 791 Score = 54.8 bits (126), Expect = 9e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -3 Query: 464 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 330 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 774 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 814 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 80.2 bits (189), Expect = 2e-15 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 498 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 400 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 33 Score = 54.8 bits (126), Expect = 9e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -3 Query: 464 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 330 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 16 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 56 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 80.2 bits (189), Expect = 2e-15 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 498 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 400 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 56 Score = 54.8 bits (126), Expect = 9e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -3 Query: 464 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 330 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 39 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 79 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 80.2 bits (189), Expect = 2e-15 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 498 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 400 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYP 33 Score = 54.8 bits (126), Expect = 9e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -3 Query: 464 GLFTVPGLLLAFCSHVLSCVIPLILWITVLPPLSELIPLAAAERP 330 G + GLLL CS + PLILWITVLPPLSELIPLAAAERP Sbjct: 16 GSWPFAGLLLT-CSFLR---YPLILWITVLPPLSELIPLAAAERP 56 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 77.8 bits (183), Expect = 1e-14 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 496 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GRSLWKNASNAAFLRFLAFCWPFAHMF+PALSP Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSP 34 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + + PDSVDNRITAF Sbjct: 22 WPFAHMF----YPALSPDSVDNRITAF 44 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 76.6 bits (180), Expect = 2e-14 Identities = 42/76 (55%), Positives = 50/76 (65%), Gaps = 3/76 (3%) Frame = -1 Query: 496 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP---*FCG*PYYRL*VS*YRSPQPNDRA 326 GRSLWKNASNAAFLRFLAFCWPF HMF PALSP C + R ++ RS + ++R Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIA--RSSRMHERR 59 Query: 325 QRVSERGSGRAPNTQT 278 + VSE R+ QT Sbjct: 60 ESVSEEAEERSIRKQT 75 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 76.2 bits (179), Expect = 3e-14 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = +2 Query: 503 TSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLP 628 TSITK DAQ+ GGETRQDYKDTRRFPL APSCALLF P LP Sbjct: 121 TSITKSDAQISGGETRQDYKDTRRFPLAAPSCALLFLPFGLP 162 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 279 VCVLGALPLPRSLTRCARSFGCGERYQLT 365 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 241 SALMNRPTRGERRFAYW 291 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.9 bits (171), Expect = 3e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 499 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 GGRSLWKNASNAAFLRFLAF WPFAHMFF ALSP Sbjct: 17 GGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSP 50 Score = 40.3 bits (90), Expect(2) = 1e-06 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 675 MRKRHASRREKGGQVSGKR 619 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 Score = 30.3 bits (65), Expect(2) = 1e-06 Identities = 20/50 (40%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Frame = -2 Query: 504 VQGGGAYGKTPATRPFYG----SWPFAGLLLTCSFLRYPPDSVDNRITAF 367 V GG + K + F WPFA + F PD VDNRITAF Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFGWPFAHMF----FRALSPDCVDNRITAF 60 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 67.3 bits (157), Expect = 2e-11 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -1 Query: 496 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 398 G KNASNAAFLRFLAFCWPFAHMFFPALSP Sbjct: 18 GAEPMKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 31.5 bits (68), Expect = 0.93 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 447 WPFAGLLLTCSFLRYPPDSVDNRITAF 367 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 64.1 bits (149), Expect = 1e-10 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = -1 Query: 610 EQESARGSFQGETPGIFIVLSGFATSDLSVDFCDARXGGRSLWKNA 473 EQESARGS QGET GIFIVLSGFAT+DLSV F DA GG + K A Sbjct: 10 EQESARGSRQGETLGIFIVLSGFATTDLSVRFRDACQGGGAYGKTA 55 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = +2 Query: 503 TSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLP 628 TSITK DAQ+ GGETRQDYKDTRR C +L P P Sbjct: 159 TSITKSDAQISGGETRQDYKDTRRLHQAGTLCGVLILPFGFP 200 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 279 VCVLGALPLPRSLTRCARSFGCGERYQLT 365 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 241 SALMNRPTRGERRFAYW 291 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) Length = 75 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 45 VVRSKLGCVHEPPVQPDRCALSG 67 >SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 Score = 35.9 bits (79), Expect = 0.043 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +3 Query: 780 YRLESXRVRHDLSPLAAALVXXIXXXRF 863 YRLES VRHDLSPLAAA I R+ Sbjct: 25 YRLESNPVRHDLSPLAAATGNRISRARY 52 >SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 34 VVRSKLGCVHEPPVQPDRCALSG 56 >SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 Score = 35.9 bits (79), Expect = 0.043 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +3 Query: 780 YRLESXRVRHDLSPLAAALVXXIXXXRF 863 YRLES VRHDLSPLAAA I R+ Sbjct: 25 YRLESNPVRHDLSPLAAATGNRISRARY 52 >SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 Score = 34.7 bits (76), Expect = 0.100 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 780 YRLESXRVRHDLSPLAAA 833 YRLES VRHDLSPLAAA Sbjct: 25 YRLESKPVRHDLSPLAAA 42 >SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 Score = 34.7 bits (76), Expect = 0.100 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 780 YRLESXRVRHDLSPLAAA 833 YRLES VRHDLSPLAAA Sbjct: 25 YRLESNPVRHDLSPLAAA 42 >SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 Score = 34.7 bits (76), Expect = 0.100 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 780 YRLESXRVRHDLSPLAAA 833 YRLES VRHDLSPLAAA Sbjct: 25 YRLESNPVRHDLSPLAAA 42 >SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 >SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 709 VVRSKLGCVHXPPVQPDRCALSG 777 VVRSKLGCVH PPVQPDRCALSG Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSG 23 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,267,133 Number of Sequences: 59808 Number of extensions: 527089 Number of successful extensions: 3181 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3174 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2503194881 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -