BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M19 (921 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 32 0.75 SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) 29 7.0 >SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) Length = 1120 Score = 31.9 bits (69), Expect = 0.75 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 148 KRLVPHPNSYFMDVKCPGCYKITTVFSHAQRV 243 KR P P ++K P Y++TT+ +H+ RV Sbjct: 428 KRTKPKPGERATEIKSPSTYQVTTMVTHSPRV 459 >SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) Length = 525 Score = 28.7 bits (61), Expect = 7.0 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = +1 Query: 259 CSTILCQPTGGRARLTEGCSFRRKQ 333 C ++CQ + ++R T+GC ++R++ Sbjct: 230 CEVLVCQRSDKKSRCTKGCPYQRRR 254 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,183,522 Number of Sequences: 59808 Number of extensions: 240193 Number of successful extensions: 537 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2669453024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -