BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_M13 (878 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 35 0.075 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 34 0.13 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 33 0.23 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 33 0.23 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 33 0.40 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 32 0.70 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 31 1.6 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 30 2.1 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 30 2.1 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 30 2.1 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 29 6.6 SB_5348| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 35.1 bits (77), Expect = 0.075 Identities = 19/66 (28%), Positives = 21/66 (31%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXGGGGX 804 PPPPPPP PPP +P + P PPP G G Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGL 753 Query: 805 LSXDPP 822 PP Sbjct: 754 PPPPPP 759 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/57 (35%), Positives = 22/57 (38%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXGG 795 PPPPPPP + GG PPP P +P P PPP GG Sbjct: 661 PPPPPPPPGGQ-----AGGAPPPPPPPLPGGAAPPPPPPIGGGAPPP---PPPGFGG 709 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +1 Query: 628 PPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPP 783 PPPPPP + G PPP AP P P PPP Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPP-PPPPVGGPPP 376 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPP 699 PPPPPPP + + G PPP Sbjct: 374 PPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 4/57 (7%) Frame = +1 Query: 625 PPPP----PPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPP 783 PPPP PPP GG PPP P + P PPP Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPP 394 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +1 Query: 673 GGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXGGGGXLSXDPP 822 GGG PPP P +P P PPP G G PP Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 31.9 bits (69), Expect = 0.70 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 673 GGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXGGGGXLSXDPP 822 GG PPP P P P PPP G GG PP Sbjct: 287 GGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPP 699 PPPPPPP G GG PPP Sbjct: 314 PPPPPPPPPPPP----GDGGAPPPP 334 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPP 783 PPPPPPP G PPP P P P PPP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP---PPP 329 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/66 (27%), Positives = 20/66 (30%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXGGGGX 804 PPPPPPP GG P P +P P PP G Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGG 979 Query: 805 LSXDPP 822 + PP Sbjct: 980 SAPPPP 985 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXGGGGX 804 PPPPPP GG P P P APP GG Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGS 980 Query: 805 LSXDPP 822 PP Sbjct: 981 APPPPP 986 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 31.9 bits (69), Expect = 0.70 Identities = 19/66 (28%), Positives = 22/66 (33%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXGGGGX 804 PPPPPPP + PPP P +P P PPP Sbjct: 380 PPPPPPPPSPPPPPQP----PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALR 435 Query: 805 LSXDPP 822 L+ PP Sbjct: 436 LACAPP 441 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPP 783 PPPPPPP P P P P P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 2/68 (2%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXP--XKAPPPXXGGG 798 PPPPP P G PP AP +P P APPP Sbjct: 245 PPPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLP 304 Query: 799 GXLSXDPP 822 S PP Sbjct: 305 NFTSPSPP 312 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/73 (27%), Positives = 25/73 (34%), Gaps = 8/73 (10%) Frame = +1 Query: 628 PPPPPPXKXKXXXK----XGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXGG 795 PPPPPP + + G PPP P +P P PPP G Sbjct: 318 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPG 377 Query: 796 ----GGXLSXDPP 822 G ++ PP Sbjct: 378 RRPPSGKINPPPP 390 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 628 PPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPP 783 PPPPP + PPP AP S P APPP Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPP 245 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/69 (27%), Positives = 21/69 (30%), Gaps = 3/69 (4%) Frame = +1 Query: 625 PPP---PPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXGG 795 PPP PPPP + K G PPP P S PPP Sbjct: 141 PPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHS 200 Query: 796 GGXLSXDPP 822 + PP Sbjct: 201 RHGSAPPPP 209 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 634 PPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPP 783 PPPP K G PPP P S APPP Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPP 312 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/73 (27%), Positives = 25/73 (34%), Gaps = 8/73 (10%) Frame = +1 Query: 628 PPPPPPXKXKXXXK----XGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXGG 795 PPPPPP + + G PPP P +P P PPP G Sbjct: 230 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPG 289 Query: 796 ----GGXLSXDPP 822 G ++ PP Sbjct: 290 RRPPSGKINPPPP 302 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 628 PPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPP 783 PPPPP + PPP AP S P APPP Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPP 157 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/69 (27%), Positives = 21/69 (30%), Gaps = 3/69 (4%) Frame = +1 Query: 625 PPP---PPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXGG 795 PPP PPPP + K G PPP P S PPP Sbjct: 53 PPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHS 112 Query: 796 GGXLSXDPP 822 + PP Sbjct: 113 RHGSAPPPP 121 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 634 PPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPP 783 PPPP K G PPP P S APPP Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPP 224 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 628 PPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPP 783 PPPPPP GG PPP P SP P PP Sbjct: 151 PPPPPPIAPAT------GGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPP 196 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPP 699 PPPPPPP G PPP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPP 699 PPPPPPP G PPP Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPPPP 408 >SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1411 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 640 GGGGGGXXXPPPPXGGGXXFLG 575 GGGGG PPPP G F G Sbjct: 716 GGGGGHSGTPPPPEIGPKSFYG 737 >SB_5348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 643 GGGGGGGXXXPPPP 602 GGGG GG PPPP Sbjct: 135 GGGGAGGTKRPPPP 148 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.3 bits (60), Expect = 8.7 Identities = 19/70 (27%), Positives = 20/70 (28%), Gaps = 4/70 (5%) Frame = +1 Query: 625 PPP----PPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXG 792 PPP PP P + GG PP P P P PPP G Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFG 488 Query: 793 GGGXLSXDPP 822 PP Sbjct: 489 PPPPFYRGPP 498 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 28.3 bits (60), Expect = 8.7 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +1 Query: 625 PPPPPPPXKXKXXXKXGGGGXXPPPXXXXXXXXXXXXAPXKXFSPXPXKAPPPXXGGGG 801 PPP P + GG PPP AP P PPP G G Sbjct: 593 PPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTGQHPPPPPAGYPG 651 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,861,012 Number of Sequences: 59808 Number of extensions: 166398 Number of successful extensions: 2592 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1481 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2502612210 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -