BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D23 (937 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 43 3e-04 At1g15830.1 68414.m01900 expressed protein 43 3e-04 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 40 0.003 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 39 0.004 At1g61080.1 68414.m06877 proline-rich family protein 38 0.007 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 38 0.010 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 38 0.013 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 36 0.039 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 36 0.051 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 35 0.067 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 35 0.089 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 35 0.089 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 35 0.089 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 34 0.12 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 34 0.12 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 34 0.16 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 34 0.16 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 34 0.16 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 33 0.21 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 33 0.27 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 33 0.27 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 33 0.27 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 33 0.27 At3g18810.1 68416.m02389 protein kinase family protein contains ... 33 0.36 At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-conta... 32 0.48 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 32 0.48 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 32 0.63 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 32 0.63 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 32 0.63 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 32 0.63 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 32 0.63 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 32 0.63 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 29 0.70 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 31 0.83 At4g18570.1 68417.m02749 proline-rich family protein common fami... 31 0.83 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 31 0.83 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 31 0.83 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 31 1.1 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 31 1.1 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 31 1.1 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 31 1.1 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 31 1.5 At3g08530.1 68416.m00990 clathrin heavy chain, putative similar ... 31 1.5 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 31 1.5 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 31 1.5 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 30 1.9 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 30 2.5 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 30 2.5 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 30 2.5 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 29 3.4 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 29 3.4 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 29 3.4 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 29 3.4 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 29 3.4 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 29 3.4 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 29 3.4 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 29 3.4 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 29 3.4 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 29 3.4 At1g29380.1 68414.m03592 hypothetical protein 29 3.4 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 29 3.4 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 29 3.4 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 29 4.4 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 29 4.4 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 29 4.4 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 29 4.4 At2g44790.1 68415.m05574 uclacyanin II strong similarity to ucla... 29 4.4 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 29 4.4 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 29 4.4 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 29 5.9 At4g33660.1 68417.m04781 expressed protein 29 5.9 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 29 5.9 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 29 5.9 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 29 5.9 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 29 5.9 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 29 5.9 At5g51300.2 68418.m06360 splicing factor-related contains simila... 28 7.7 At5g51300.1 68418.m06359 splicing factor-related contains simila... 28 7.7 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 28 7.7 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 28 7.7 At4g20020.2 68417.m02930 expressed protein 28 7.7 At4g20020.1 68417.m02931 expressed protein 28 7.7 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 28 7.7 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 28 7.7 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 SPP P P PPP G P PPP G PPPPPP G P Sbjct: 383 SPPPPPPPSAAA--PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPP 433 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/66 (31%), Positives = 26/66 (39%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFFXXXK 529 +PP P + P PPP P PPP + PPPPPP G P Sbjct: 371 APPAPPGPANQTSPPP--PPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMS 428 Query: 528 RXGGPQ 511 + G P+ Sbjct: 429 KKGPPK 434 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 +PP P P PPP G P PPP G PP PP Sbjct: 394 APPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKG--PPKPP 436 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPPXXXGGXT 551 PP G K PPPP PP PP G T Sbjct: 410 PPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGPT 443 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = -1 Query: 670 FSXFXXPPXFWGGKXXX--PPPPXVXGXXPPPPPPXXXG 560 F+ PP G PPPP PPPPPP G Sbjct: 366 FTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKG 404 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 42.7 bits (96), Expect = 3e-04 Identities = 32/112 (28%), Positives = 37/112 (33%), Gaps = 9/112 (8%) Frame = -2 Query: 732 GGXVFFFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXP--PPXEXGGXXPP-----PPP 574 GG +PP + P PP GGG P P PP + GG P PPP Sbjct: 114 GGETVIPGAPPPIRGGGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPP 173 Query: 573 PXXGGGXPXF--FXXXKRXGGPQXIXXXXXXXXXXXXXXXXXXGFXPPXXXG 424 GGG P KR GG + + G PP G Sbjct: 174 KRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGG 225 Score = 41.5 bits (93), Expect = 8e-04 Identities = 28/85 (32%), Positives = 33/85 (38%), Gaps = 9/85 (10%) Frame = -2 Query: 732 GGXVFFFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXP--PPXEXGGXXPP-----PPP 574 GG +PP + P PP GGG P P PP + GG P PPP Sbjct: 162 GGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPP 221 Query: 573 PXXGGGXPXF--FXXXKRXGGPQXI 505 GGG P KR GG + + Sbjct: 222 KRGGGGEPVIPGAPLPKRGGGGESV 246 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/65 (33%), Positives = 25/65 (38%), Gaps = 6/65 (9%) Frame = -2 Query: 732 GGXVFFFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXP--PPXEXGG----XXPPPPPP 571 GG +PP + P PP GGG P P P + GG P PPP Sbjct: 194 GGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPLPKRGGGGESVVPGAPPP 253 Query: 570 XXGGG 556 GGG Sbjct: 254 KRGGG 258 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 7/42 (16%) Frame = +1 Query: 550 GXXPPXXGGGG----GGXXPPXLXGGG---XXXXSPPKXGGG 654 G PP GGGG G PP GGG PPK GGG Sbjct: 121 GAPPPIRGGGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGGG 162 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 7/42 (16%) Frame = +1 Query: 550 GXXPPXXGGGG----GGXXPPXLXGGG---XXXXSPPKXGGG 654 G PP GGGG G PP GGG PPK GGG Sbjct: 153 GAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGG 194 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 7/42 (16%) Frame = +1 Query: 550 GXXPPXXGGGG----GGXXPPXLXGGG---XXXXSPPKXGGG 654 G PP GGGG G PP GGG PPK GGG Sbjct: 185 GAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGG 226 Score = 28.7 bits (61), Expect = 5.9 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 7/42 (16%) Frame = +1 Query: 550 GXXPPXXGGGGGGXXP----PXLXGGG---XXXXSPPKXGGG 654 G PP GGGG P P GGG PPK GGG Sbjct: 217 GAPPPKRGGGGEPVIPGAPLPKRGGGGESVVPGAPPPKRGGG 258 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 P PPP G G PPP G PPPPP G G Sbjct: 737 PVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPPAGRG 773 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPPXXXGGXTXFFXXGXKXGGAPXXKXP 497 PP PPPP PPPPP G + G K AP P Sbjct: 718 PPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPP 769 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P K P PPP G PP PPPPPP Sbjct: 646 PPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTP--PPPPPPPP 688 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 +PP + P PPP PPP PPPPP G G Sbjct: 700 APPPLPPSSTRLGAPPPPPPPPLS--KTPAPPPPPLSKTPVPPPPPGLGRG 748 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 5/40 (12%) Frame = -2 Query: 654 PPPXFGGGX-----PXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP GG P PP GG PPPPPP GGG P Sbjct: 654 PPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPP--GGGPP 691 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP GGG PPP GG PPPPPP Sbjct: 682 PPPPPGGG----PPPPPGGGPPPPPPPP 705 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP GGG P PPP G PPPPP GGG P Sbjct: 672 PPLPGGGPPPPPPPPGGG----PPPPP--GGGPP 699 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPPXXXG 560 PP GG PPPP G PPPPPP G Sbjct: 683 PPPPGGG----PPPPPGGGPPPPPPPPGALG 709 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = -1 Query: 649 PXFWGGKXXXPPPPXVXGXXPPP-----PPPXXXGGXTXFFXXGXKXGGAP 512 P GG PPPP G PPP PPP G G K AP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGGGNKVHRAP 722 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPP 610 P PPP GGG P PPP Sbjct: 686 PGGGPPPPPGGGPPPPPPP 704 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 +PP P P PPP P PPP PPPPPP Sbjct: 522 APPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 524 PPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 P PPP P PPP PPPPPP G Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPG 557 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPP-PXEXGGXXPPPPPP 571 +PP P P PPP P PP P G PPPPP Sbjct: 548 APPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPP 594 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFG---GGXPXXPPPXEXG-GXXPPPPPP 571 +PP P + P P P GG P PPP G PPPPPP Sbjct: 561 APPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPP 610 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Frame = -2 Query: 708 SPPXXXXPXXKXF---FPXFXPPPXFGG--GXPXXPPPXEXGGXXPPPPPPXXG 562 +PP P K P PPP P PPP PPPPPP G Sbjct: 491 APPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPG 544 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPX---EXGGXXPPPPPPXXG 562 P P P G P PPP G PPPPPP G Sbjct: 592 PPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMG 629 Score = 33.1 bits (72), Expect = 0.27 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG----GGXP 550 +PP P P PPP P PPP P PPP G GG P Sbjct: 535 APPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPP 591 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 6/50 (12%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXF---GGGXPXXPPP---XEXGGXXPPPPP 574 PP P P PPP G P PPP G PPPPP Sbjct: 592 PPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPPP 641 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 10/65 (15%) Frame = -2 Query: 714 FXSPPXXXXPXX----KXFFPXFXPPPXFG---GGXPXXPPPXEXG---GXXPPPPPPXX 565 F PP P K F P PP F G P PPP PPPPPP Sbjct: 472 FAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPR 531 Query: 564 GGGXP 550 P Sbjct: 532 AAVAP 536 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = -2 Query: 714 FXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 F +PP P P PPP + P PPP PPPPPP Sbjct: 417 FSTPPTLTSPP-----PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPP 459 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP + P PPP PPPPPP Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPP 472 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P F PP P PPP PPPPPP Sbjct: 415 PIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPP 446 Score = 34.7 bits (76), Expect = 0.089 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 427 PPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPP 471 Score = 34.7 bits (76), Expect = 0.089 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP + P PPP PPPPPP Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP P PPP PPPPPP Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPP 502 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 SPP P P PPP P PPP PPPPP Sbjct: 425 SPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 470 Score = 32.3 bits (70), Expect = 0.48 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP V PPPPPP Sbjct: 458 PPPPPVYSPPPPPPPP 473 Score = 32.3 bits (70), Expect = 0.48 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP V PPPPPP Sbjct: 489 PPPPPVYSPPPPPPPP 504 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP + P PPP PPPP P Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP P P PPP P PPP PPPPP P Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523 Score = 31.5 bits (68), Expect = 0.83 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPP 572 PP ++ PPPP V PPPPPP Sbjct: 644 PPVYYSS----PPPPPVYYSSPPPPPP 666 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = -2 Query: 723 VFFFXSPPXXXXPXXKXF-FPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 ++ + SPP P P + PPP P PPP PPPPPP Sbjct: 585 IYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIE--YSPPPPPP 634 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPP-PXEXGGXXPPPPPP 571 PP P + P PPP + P P P PPPPPP Sbjct: 499 PPPPPPPPPPVYSPP--PPPVYSSPPPPPSPAPTPVYCTRPPPPPP 542 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P + P PPP PPP PPPPPP Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP----PPPPPP 493 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/57 (28%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Frame = -2 Query: 705 PPXXXXPXXKXFF-----PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP P + ++ P PP P PPP PPPPP P Sbjct: 547 PPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPP 603 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPP-------PPPPPP 478 Score = 28.7 bits (61), Expect = 5.9 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPX--EXGGXXPPPPPPXXGGGXPXFF 541 SPP P P + PPP P PPP PPPPPP P + Sbjct: 465 SPPPPPPPPPPPP-PVYSPPPP---SPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVY 518 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP V PPPPP Sbjct: 630 PPPPPVVHYSSPPPPP 645 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 619 PPPPXVXGXXPPPPP 575 PPPP V PPPPP Sbjct: 641 PPPPPVYYSSPPPPP 655 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP + P PPP PPPPPP P Sbjct: 643 PPPVYYSSPP--PPPVYYSS--PPPPPPVHYSSPP 673 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P F PPP P PPP E PPPPPP Sbjct: 78 PLFPPPPLPRLPPPLLPPPEEPPREPPPPPPP 109 Score = 35.5 bits (78), Expect = 0.051 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PP E PPPPPP Sbjct: 64 PPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPP 108 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 SPP P F P PP F P PPP P PPP Sbjct: 51 SPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPP 96 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 717 FFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPP 577 F PP P P PPP P PPP PPPP Sbjct: 73 FELPPPLFPPPPLPRLPPPLLPPPE---EPPREPPPPPPPPEEPPPP 116 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 35.9 bits (79), Expect = 0.039 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 633 GXPXXPPPXEXGGXXPPPPPP 571 G P PPP GG PPPPPP Sbjct: 636 GSPSPPPPSMSGGAPPPPPPP 656 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 P PP + G PPPPPP Sbjct: 36 PSPPPMSGRVPPPPPP 51 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP + PPPPPP Sbjct: 151 PPPPPMPRRSPPPPPP 166 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPPP Sbjct: 27 PPPPMRRSAPS-PPPMSGRVPPPPPPPP 53 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP--XXXGGXT 551 PPPP + G PPPPPP T Sbjct: 640 PPPPSMSGGAPPPPPPPPMLVASRT 664 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/18 (61%), Positives = 12/18 (66%), Gaps = 2/18 (11%) Frame = -1 Query: 619 PPP--PXVXGXXPPPPPP 572 PPP P + G PPPPPP Sbjct: 698 PPPTLPSMSGGAPPPPPP 715 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 35.5 bits (78), Expect = 0.051 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP + P PPP PPPPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 717 FFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 F SPP P P PPP P PPP PPPP P Sbjct: 372 FGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -1 Query: 670 FSXFXXPPXFWGGKXXXPPPPXVXGXXPPPPPP 572 FS + +G PPPP PPPPPP Sbjct: 362 FSSYPIDCASFGCSPPSPPPPPPPPPPPPPPPP 394 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P +P PPP PPP PPPP P Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPY--VYPPPPSP 440 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 35.1 bits (77), Expect = 0.067 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 559 PPXXGGGGGGXXPPXLXGGGXXXXSPPKXGG 651 PP GGGGGG P GG PP GG Sbjct: 40 PPQHGGGGGGGSKPPPHHGGKGGGKPPPHGG 70 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 559 PPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 P GGGGGG PP GG PP G G Sbjct: 41 PQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKG 72 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = -2 Query: 687 PXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG-GGXPXFFXXXKRXGG 517 P + P PP GGG PP GG PPP G GG P GG Sbjct: 29 PCTRPHPPVPKPPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGG 86 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 207 GXXXPPPPKXGGXGAXKKKKXXGXGGPPPEKXG 305 G PPP GG G K G GG PP G Sbjct: 48 GGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGG 80 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 559 PPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 PP GG GGG PP GG PP GGG Sbjct: 54 PPHHGGKGGGKPPPHGGKGG----GPPHHGGG 81 Score = 31.5 bits (68), Expect = 0.83 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 514 GPPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPP 639 G P K G PP GG GGG P GGG SPP Sbjct: 50 GSKPPPHHGGKGGGKPPPHGGKGGG-PPHHGGGGGGGGKSPP 90 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 558 PPXXXGGGGGGFXPXTXGGGGXXXFPPQXXG 650 PP GGGGGG P GG PP G Sbjct: 40 PPQHGGGGGGGSKPPPHHGGKGGGKPPPHGG 70 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 34.7 bits (76), Expect = 0.089 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPP-PPXXGGGXPXFFXXXKRXGG 517 P PPP PPPP PP GGG ++ + GG Sbjct: 53 PSPPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGG 90 Score = 34.7 bits (76), Expect = 0.089 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFF 541 SPP P P PP GGG PP G PPP GGG ++ Sbjct: 54 SPPPPSTPTTAC--PPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYY 107 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 PP P + PPP GG PPP GG PPP G Sbjct: 66 PPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYYPPPYSG 113 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 559 PPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 PP GGG PP GG PP GGG Sbjct: 71 PPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGG 102 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = -1 Query: 619 PPPPXVX--GXXPPPPPPXXXGGXTXFFXXGXKXGGAPXXKXP 497 PPPP PPP PP GG + ++ + GG P Sbjct: 55 PPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPP 97 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +1 Query: 517 PPXPFXXXKKXGXX---PPXXGGGGGGXXPPXLXGGGXXXXSPPKXGG 651 PP P G PP GGG PP GGG PP G Sbjct: 66 PPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYYPPPYSG 113 Score = 31.5 bits (68), Expect = 0.83 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PPP GGG PP G PPPP Sbjct: 95 PPPYGGGGQGYYYPPPYSGNYPTPPPP 121 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP +GGG P G P PPPP Sbjct: 95 PPPYGGGGQGYYYPPPYSGNYPTPPPP 121 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 34.7 bits (76), Expect = 0.089 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P F P PPP P PPP PPPP P Sbjct: 27 PPSHISPPPPPFSPPHHPPPPH-FSPPHQPPPSPYPHPHPPPPSP 70 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 SPP P +P PPP P PPP PPPP P G Sbjct: 50 SPPHQPPPSP---YPHPHPPPPSPYPHPHQPPPPPH-VLPPPPPTPAPG 94 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 34.7 bits (76), Expect = 0.089 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP GG P PP GG PPPP G P Sbjct: 253 PPPHIGGSAP---PPPHMGGSAPPPPHMGQNYGPP 284 Score = 34.7 bits (76), Expect = 0.089 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 8/43 (18%) Frame = -2 Query: 654 PPPXFGGGXP----XXPPPXEXGGXXPPP----PPPXXGGGXP 550 PPP +GG P PP GG PP PPP GG P Sbjct: 319 PPPNYGGAPPANNMGGAPPPNYGGGPPPQYGAVPPPQYGGAPP 361 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGG 559 PP P PPP GG PPP G PPPP GG Sbjct: 246 PPMGGPPPPPHIGGSAPPPPHMGGS---APPPPHMGQNYGPPPPNNMGG 291 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPP---PPXXGGGXP 550 PPP G PPP GG PPP PP G P Sbjct: 272 PPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGP 309 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 636 GGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 GG P PP GG PPPPP GG P Sbjct: 239 GGPPPQRPPM--GG---PPPPPHIGGSAP 262 Score = 28.7 bits (61), Expect = 5.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 619 PPPPXVXGXXPPPP 578 PPPP + G PPPP Sbjct: 252 PPPPHIGGSAPPPP 265 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 207 GXXXPPPPKXGGXGAXKKKKXXGXGGPPPEKXG 305 G PPPP GG G PPP G Sbjct: 258 GGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMG 290 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P P FP PPP P PPP PPPPPP Sbjct: 1088 PSSLPPPPPAALFPPLPPPPSQPPPPPLSPPP----SPPPPPPPP 1128 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 1111 PPPPLSPPPSPPPPPP 1126 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 SPP P P PPP P PPP + PPPPP Sbjct: 1078 SPPPPSPPLPPSSLP---PPPPAALFPPLPPPPSQ-----PPPPP 1114 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXF 544 P P + P PPP P PP PPPPPP P F Sbjct: 520 PAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVF 573 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPP---PPPP 571 PP P + P PPP P PP PP PPPP Sbjct: 545 PPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPP 592 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPP-PXFGGGXPXXPPPXEXGGXXPPPPPP 571 SPP P P F PP P + P PP PPPP P Sbjct: 557 SPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPV--HSPPPPAP 601 Score = 28.3 bits (60), Expect = 7.7 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPP---PPPP 571 SPP P P PPP P PPP PP PPPP Sbjct: 532 SPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVH--SPPPPVFSPPPP 578 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP + P PPP P PPP PPPPPP Sbjct: 17 PPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPP 61 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 PPP PPP G PPPPPP G Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNG 262 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = -2 Query: 723 VFFFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 V+F + P P PPP PPP G PPPPP G P Sbjct: 208 VYFKPTKPEPNKPQSAVGANGLPPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRP 265 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 PPP G P PPP G P PP G Sbjct: 243 PPPPPSGLFPPPPPPMANNGFRPMPPAGGFG 273 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PP + PPPPPP Sbjct: 9 PPLPQPPSQNSLAPP-PPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP F P PPP PPPPPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPP 61 Score = 31.5 bits (68), Expect = 0.83 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 669 FPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 FP PPP P PPP PPPPPP Sbjct: 38 FPQSPPPP------PPPPPPPPPPPPPPPPPPP 64 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPP 62 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPP 63 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPP 577 P PPP G G P PPP G PPPP Sbjct: 389 PPPAPPP--GSGGPKPPPPPGPKGPRPPPP 416 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXE---XGGXXPPPPPPXXGGGXP 550 P P G P PPP GG PPPPP G P Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPP 414 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPP 577 PPP G P PPP G P PP Sbjct: 402 PPPPPGPKGPRPPPPMSLGPKAPRPP 427 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPP 577 P PPP G G P PPP G PPPP Sbjct: 389 PPPAPPP--GSGGPKPPPPPGPKGPRPPPP 416 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXE---XGGXXPPPPPPXXGGGXP 550 P P G P PPP GG PPPPP G P Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPP 414 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPP 577 PPP G P PPP G P PP Sbjct: 402 PPPPPGPKGPRPPPPMSLGPKAPRPP 427 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 33.1 bits (72), Expect = 0.27 Identities = 33/103 (32%), Positives = 37/103 (35%), Gaps = 12/103 (11%) Frame = -2 Query: 822 APPTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFXPPPX 643 APP PP PP GG +G + PP P + F PPP Sbjct: 155 APPII--RPPGQMLPPPPFGG--------QGPPMGRGPPPPYGMRPPPQQFSGP--PPPQ 202 Query: 642 FG--------GGXPXXPPPXEXGGXXPPPP----PPXXGGGXP 550 +G GG PPP G PPPP PP GG P Sbjct: 203 YGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAP 245 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 33.1 bits (72), Expect = 0.27 Identities = 33/103 (32%), Positives = 37/103 (35%), Gaps = 12/103 (11%) Frame = -2 Query: 822 APPTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFXPPPX 643 APP PP PP GG +G + PP P + F PPP Sbjct: 155 APPII--RPPGQMLPPPPFGG--------QGPPMGRGPPPPYGMRPPPQQFSGP--PPPQ 202 Query: 642 FG--------GGXPXXPPPXEXGGXXPPPP----PPXXGGGXP 550 +G GG PPP G PPPP PP GG P Sbjct: 203 YGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAP 245 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXGG 557 PPPP PPPPPP GG Sbjct: 269 PPPPGSWQPSPPPPPPPVSGG 289 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPPXXGG 559 P PPP PPPPPP GG Sbjct: 267 PPPPPPGSWQPSPPPPPPPVSGG 289 >At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-containing protein similar to P58 protein, Bos primigenius taurus, PIR:A56534; similar to p58 (GI:1353270) {Homo sapiens}; contains Pfam PF00226: DnaJ domain; contains Pfam PF00515: TPR Domain Length = 482 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +3 Query: 573 GGGGGGFXPXTXGGGGXXXFPPQXXGG 653 GGGGGG+ P GGGG + GG Sbjct: 443 GGGGGGYNPFHGGGGGGQQYTFHFEGG 469 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 32.3 bits (70), Expect = 0.48 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 550 GXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGGXKXXK 669 G P GGG G PP GGG SP K GGG K K Sbjct: 411 GSGSPPSTGGGSG-SPPSTGGGG---GSPSKGGGGGKSGK 446 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 550 GXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 G P GGG G PP GG SPP GGG Sbjct: 402 GGGSPSPGGGSGS--PPSTGGGS---GSPPSTGGG 431 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 576 GGGGGFXPXTXGGGGXXXFPPQXXGGXK 659 GGG G P T GGGG P + GG K Sbjct: 419 GGGSGSPPSTGGGGGS---PSKGGGGGK 443 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = -2 Query: 723 VFFFXSPPXXXXPXXKXFFPXFXPPPXFGGGX----PXXPPPXEXGGXXPPPPPP 571 V F PP P PPP PPP + G PPPPPP Sbjct: 157 VLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPP 211 Score = 31.5 bits (68), Expect = 0.83 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGX--PXXPPPXEXG---GXXPPPPPPXXGG 559 SPP P ++ PPP + G P PPP + PPPPPP G Sbjct: 178 SPPPPR-PQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYG 231 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/85 (23%), Positives = 25/85 (29%), Gaps = 3/85 (3%) Frame = -2 Query: 819 PPTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFXPPPXF 640 PP PP PP + ++ P +P PPP Sbjct: 155 PPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQA 214 Query: 639 GGGX---PXXPPPXEXGGXXPPPPP 574 P PPP + G PPPP Sbjct: 215 ARSYKRSPPPPPPSKYGRVYSPPPP 239 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 11/46 (23%) Frame = -2 Query: 654 PPPXFGGGXP--XXPPPXEXGGXXPPP---------PPPXXGGGXP 550 PPP GG P PP + G PPP PPP GG P Sbjct: 68 PPPSSSGGGPYYYYPPASQSGSYRPPPSSSSGGYYYPPPKSGGNYP 113 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -2 Query: 660 FXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 + PPP G PPP + GG P PPP Sbjct: 90 YRPPPSSSSGGYYYPPP-KSGGNYPYTPPP 118 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 6/38 (15%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPP-PXEXGGXXP-----PPPPP 571 P P P GGG P P P + GG P PPPPP Sbjct: 138 PGMAPIPGQGGGPPGMAPIPGQGGGPPPNYNGLPPPPP 175 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/53 (37%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPP--PPPPXXGGGXPXFFXXXKRXGGP 514 P PP G P PPP + G PP P P GGG P + GGP Sbjct: 116 PQMMAPP----GAPLPPPP-QNGILRPPGMAPIPGQGGGPPGMAPIPGQGGGP 163 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -3 Query: 293 RGXXPXPXXFFFFXGPXXPPFGGGGXXGP 207 RG P P FF GP P +GGGG GP Sbjct: 59 RGPDPGPGFFFGGAGP-GPGYGGGGGHGP 86 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 550 GXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 G P G GGGG P GGG + GGG Sbjct: 70 GGAGPGPGYGGGGGHGPGYGGGGDGRGYGSETGGG 104 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 31.9 bits (69), Expect = 0.63 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP P P P PPPPPP Sbjct: 154 PESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 573 GGGGGGFXPXTXGGGGXXXFPPQXXGG 653 GGGGGGF G GG F PQ G Sbjct: 840 GGGGGGFGGLGSGTGGFGGFAPQGSSG 866 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 28.7 bits (61), Expect(2) = 0.70 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P F PPP PPP PPPP P Sbjct: 120 PEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAP 151 Score = 21.8 bits (44), Expect(2) = 0.70 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -2 Query: 819 PPTXXKNPPXFFXXPP 772 PP NPP F PP Sbjct: 111 PPPSTPNPPPEFSPPP 126 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 31.5 bits (68), Expect = 0.83 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGG 559 PP G G P PPP P PPPP GG Sbjct: 165 PPFAGQGGP--PPPYGMRPPYPGPPPPQYGG 193 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -2 Query: 702 PXXXXPXXKXFFPXFXPPPXFGGGXP-XXPPPXEXGGXXPPPPPPXXGG 559 P P F PPP +G P PPP + GG P P GG Sbjct: 157 PPGQMPPQPPFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGG 205 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -2 Query: 654 PPPXFGG-GXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP +GG P PP GG PPPP G P Sbjct: 187 PPPQYGGQQRPMMIPP--PGGMMRGPPPPHGMQGPP 220 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXF 544 P PPP GG PPP G P P GG P F Sbjct: 197 PMMIPPP--GGMMRGPPPPHGMQGPPPSRPGMPPPGGAPMF 235 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 31.5 bits (68), Expect = 0.83 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP V PPPPPP Sbjct: 325 PPPPSVSKAPPPPPPP 340 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 324 PPPPPSVSKAPPPPPP 339 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP + PPP PPPPPP Sbjct: 74 PPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRP--LPPPPPPP 116 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPP 580 PP P + P PPP P P P + G PPP Sbjct: 708 PPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTPPP 749 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPP 577 PP P + P PPP P PP + PP P Sbjct: 152 PPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTP 194 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PP P + P PPP P PP + PP P Sbjct: 202 PPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTP 245 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PP P + P PPP P PP + PP P Sbjct: 236 PPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTP 279 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPP 577 PP P + P PPP P PP + PP P Sbjct: 438 PPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTP 480 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PP P + P PPP P PP + PP P Sbjct: 538 PPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTP 581 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PP P + P PPP P PP + PP P Sbjct: 555 PPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 598 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PP P + P PPP P PP + PP P Sbjct: 572 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 615 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PP P + P PPP P PP + PP P Sbjct: 589 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 632 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PP P + P PPP P PP + PP P Sbjct: 606 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 649 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PP P + P PPP P PP + PP P Sbjct: 623 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTP 666 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXF-----GGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP P + P PPP P PPP + P PP G G P Sbjct: 691 PPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTP 747 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PP P + P PPP P PP + PP P Sbjct: 219 PPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTP 262 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PP P + P PPP P PP + PP P Sbjct: 270 PPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTP 313 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PP P + P PPP P PP + PP P Sbjct: 354 PPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTP 397 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPP 577 PP P + P PPP P PP + PP P Sbjct: 388 PPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTP 430 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PPP P PPP PPPPP Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -1 Query: 634 GKXXXPPPPXVXGXXPPPPPP 572 G+ PPPP PPPPP Sbjct: 261 GRSAPPPPPAAAPPPQPPPPP 281 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 31.1 bits (67), Expect = 1.1 Identities = 23/116 (19%), Positives = 31/116 (26%), Gaps = 3/116 (2%) Frame = -2 Query: 879 PGPLRVFXXKXXXXXXXXGAPPTXXKNPPXFFXXPPG---GGGXXFFYXXXKGGXVFFFX 709 P P V+ PP +P ++ PP Y V Sbjct: 579 PSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAPSPKVLYKSPPHPHVCVCP 638 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFF 541 PP P K + PP + P P PPPP P ++ Sbjct: 639 PPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKSPPPPYVYSSPPPPYY 694 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/57 (31%), Positives = 20/57 (35%) Frame = -2 Query: 714 FXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXF 544 + PP P + P PPP G PPP G PP P G P F Sbjct: 29 YPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPP---GAYPPAGYPGPSGPRPGF 82 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 31.1 bits (67), Expect = 1.1 Identities = 23/88 (26%), Positives = 28/88 (31%), Gaps = 5/88 (5%) Frame = -2 Query: 819 PPTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFXPPPXF 640 PP +PP + PP + Y + P P K + PPP Sbjct: 323 PPVKHYSPPPVYHSPPPPK-KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV 381 Query: 639 GGGXPXX-----PPPXEXGGXXPPPPPP 571 P PPP E PPPPP Sbjct: 382 KHYSPPPVYHSPPPPKEKYVYKSPPPPP 409 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = -2 Query: 723 VFFFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 + F PP P P PPP F P + PPPPPP Sbjct: 4 ILSFTPPPPPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPPP 54 >At3g08530.1 68416.m00990 clathrin heavy chain, putative similar to Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo sapiens] Length = 1703 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P P GGG PPP G PP PP Sbjct: 1667 PMPGMGGGGGYGPPPQMGGMPGMPPMPP 1694 >At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 147 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = -2 Query: 732 GGXVFFFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 GG +++ PP K PPP G G PP G PPPP Sbjct: 61 GGGSYYYSPPPPSSSGGVKY------PPPYGGDGYGGYYPPPYYGNYGTPPPP 107 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/52 (32%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = -2 Query: 687 PXXKXFFPXFXPPPXFGGGXPXX---PPPXEXGGXXPPPPPPXXGGGXPXFF 541 P + P PP GGG PPP GG PPP G G ++ Sbjct: 44 PVPSSYSPPPPPPSSSGGGGSYYYSPPPPSSSGGVKYPPP--YGGDGYGGYY 93 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXX--PPPPPPXXGGG 556 PP K PPP P P P G PPPPPP GG Sbjct: 235 PPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGARGG 286 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P P + ++P PP P PPP PPPPPP Sbjct: 581 PKYEQTPSPREYYPSPSPPYYQYTSSP--PPPTYYATQSPPPPPP 623 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = -2 Query: 654 PPPXFGG--GXPXXPPPXEXGGXXPPPPPP 571 PPP + P PPP PPPPPP Sbjct: 608 PPPTYYATQSPPPPPPPTYYAVQSPPPPPP 637 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = -2 Query: 660 FXPPPXFGGGXPXXPPPXEXGGXXPP---PPPPXXGGGXP 550 + PPP P PPP PP PPPP P Sbjct: 527 YPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPP 566 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXV----XGXXPPPPPP 572 PP ++ PPPP V PPPPPP Sbjct: 650 PPVYYTPVIQSPPPPPVYYSPVTQSPPPPPP 680 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPP--PPP 572 PP + PPPP + PPP PPP Sbjct: 56 PPPVYSRPVAFPPPPPIYSPPPPPIYPPP 84 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPP PP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPP P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSP 92 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFFXXXKRXGG 517 PPP P PPP PPPP P P F K G Sbjct: 64 PPPP----PPTSPPPPSPPPPSPPPPSPPPPSPPPPAFAVGKTPEG 105 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = -2 Query: 687 PXXKXFFPXFXPPPXF-----GGGXPXXPPPXEXGGXXPPPPPP 571 P K P PPP P PPP + G PPPPP Sbjct: 229 PQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPP 272 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 5/40 (12%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPX-----EXGGXXPPPPPPXXGGGXP 550 PPP P PPP + P PPPP G P Sbjct: 227 PPPQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSP 266 >At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) identical to fibrillarin 1 GI:9965653 from [Arabidopsis thaliana]; C-terminus identical to SKP1 interacting partner 7 GI:10716959 from [Arabidopsis thaliana]; contains Pfam domain PF01269: Fibrillarin Length = 308 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +3 Query: 558 PPXXXGGGGGGFXPXTXGGGGXXXFPPQXXGGXKXXEKNXXXRXRXXRGGXXXXXXPP 731 PP G GGGGF GGG GG R R RG PP Sbjct: 3 PPVTGGRGGGGFRGGRDGGGRGFGGGRSFGGGRSGDRGRSGPRGR-GRGAPRGRGGPP 59 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -2 Query: 678 KXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 K P PPP PPP PP PPP Sbjct: 403 KPLLPTLPPPPVIEITRDPSPPPSPVQPPPPPSPPP 438 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPPP Sbjct: 24 PPPP-----PPPPPPMRRRAPLPPPPPP 46 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPP 571 P PPP PPPPPP Sbjct: 42 PPPPPPMRRRAPLPPPPPP 60 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXG 560 PPPP V PPPPP G Sbjct: 801 PPPPPVIHHSQPPPPPIYEG 820 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 619 PPPPXVXGXXPPPPP 575 PPPP V PPPPP Sbjct: 66 PPPPYVYNSPPPPPP 80 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 65 PPPPPYVYNSPPPPPP 80 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXG 560 PPPP V PPPP P G Sbjct: 456 PPPPPVHHSSPPPPSPEFEG 475 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = -1 Query: 706 PPLXXRXLXKXFFSXFXXPPXFWGGKXXXPPPPXVXGXXPPPPP 575 PP+ FS PP + PPPP + PPPPP Sbjct: 422 PPVYSPPPSPPVFSPPPSPPVY-----SPPPPPSIHYSSPPPPP 460 Score = 28.3 bits (60), Expect = 7.7 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 SPP P + PPP P PPP PPPP P G P Sbjct: 430 SPPVFSPPPSPPVYSP-PPPPSIHYSSPP-PPPVHHSS--PPPPSPEFEGPLP 478 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P + PPP P PPP PPPPPP Sbjct: 514 PVYSPPPPPPVYSPPPPPPV----YSPPPPPP 541 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXF 544 PP P P PPP P PP PPPPPP P F Sbjct: 582 PPVYSPPPPPVHSP---PPPVHSPPPPVHSPPPPV--YSPPPPPPVHSPPPPVF 630 Score = 28.3 bits (60), Expect = 7.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 723 VFFFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 V F SPP P PPP P PP PPPPPP Sbjct: 487 VKFRRSPPPPPVHSPPPPSPIHSPPPP-----PVYSPPPPPPVYSPPPPPP 532 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 3/48 (6%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPP---PPPP 571 PP P + PPP P PP PP PPPP Sbjct: 522 PPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPP---PPPP 571 PP P + P PPP P PP PP PPPP Sbjct: 603 PPPVHSPPPPVYSPP-PPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPP 649 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 P PPP P PPP PPPP Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPP 96 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 P PPP P PPP PPPP Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPP 96 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = -2 Query: 660 FXPPPXFGGGXPXXPPPXEXGGXXPP---PPPP 571 + PPP P PPP PP PPPP Sbjct: 573 YSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = -2 Query: 654 PPPXFGGGXPXX---PPPXEXGGXXPPPPPPXXGGGXPXFF 541 PPP + P PPP P PPPP P F Sbjct: 560 PPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVF 600 Score = 28.3 bits (60), Expect = 7.7 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 5/60 (8%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXP--XXPPPXEXGGXXPP---PPPPXXGGGXPXF 544 SPP P P PPP F P PPP PP PPPP P F Sbjct: 581 SPPPPSPPPPVHSPP---PPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTF 637 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 573 GGGGGGFXPXTXGGGG 620 GGGGGG+ T GGGG Sbjct: 101 GGGGGGYGGGTPGGGG 116 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 550 GXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 G P GGGGGG GGG GGG Sbjct: 108 GGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGG 142 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPP 571 P PP + G PPPPPP Sbjct: 261 PPPPPKLKNNGPSPPPPPP 279 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/52 (30%), Positives = 18/52 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP + P PPP P P P + PPPPPP P Sbjct: 226 PPHVKTDSFEFVKPDPTPPPP-----PPPPIPVKQSATPPPPPPPKLKNNGP 272 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P P P P PPP + P PPPP Sbjct: 246 PPPPPIPVKQSATPPPPPPPKLKNNGPSPPPP 277 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 619 PPPPXVXGXXPPPPP 575 PPPP V PPPPP Sbjct: 513 PPPPYVYSSPPPPPP 527 Score = 28.7 bits (61), Expect = 5.9 Identities = 22/93 (23%), Positives = 29/93 (31%) Frame = -2 Query: 819 PPTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFXPPPXF 640 PP+ PP + PP + V+ PP + PPP + Sbjct: 461 PPSPSPPPPYVYSSPPP---PYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPY 517 Query: 639 GGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFF 541 P PPP PPPP P P + Sbjct: 518 VYSSPPPPPP------SPPPPCPESSPPPPVVY 544 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P PPP P P P PPPPPP Sbjct: 691 PPPPPPPMQHSTVTKVPPPPP--PAPPAPPTPIVHTSSPPPPPPP 733 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PP P V PPPPPP Sbjct: 717 PPTPIVHTSSPPPPPP 732 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 90 PPPPPPIENLPPPPPP 105 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/96 (20%), Positives = 30/96 (31%), Gaps = 3/96 (3%) Frame = -2 Query: 819 PPTXXKNPPXFFXXPPG---GGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFXPP 649 PP +P ++ PP +Y V+ PP P K ++ PP Sbjct: 532 PPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYS-SPPPPYYSPSPKVYYKSPPPP 590 Query: 648 PXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFF 541 + P P PPPP P ++ Sbjct: 591 YVYSSPPPPYHSPSPKVQYKSPPPPYVYSSPPPPYY 626 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 24 PPPPPYYYLDPPPPPP 39 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 25 PPPPYYYLDPPPPPPP 40 >At2g44790.1 68415.m05574 uclacyanin II strong similarity to uclacyanin II GI:3399769 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin II GI:3399768 Length = 202 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGG 559 PP P P GG P P G PPPPP G Sbjct: 131 PPATPTPPSSTPGTPTTPESPPSGGSPTPTTPTPGAGSTSPPPPPKASG 179 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPP 571 P PPP PPPPPP Sbjct: 55 PSSPPPLSLSPSSPPPPPP 73 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPP 571 P PPP PPPPPP Sbjct: 104 PSSPPPLSLSPSSPPPPPP 122 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/52 (30%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXX---PPPXEXGGXXPPPPPPXXGG 559 PP +P PPP + PPP GG PP P GG Sbjct: 13 PPGYQSHYPPPGYPSAPPPPGYPSPPSHHEGYPPPQPYGGYPPPSSRPYEGG 64 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/93 (21%), Positives = 29/93 (31%) Frame = -2 Query: 819 PPTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFXPPPXF 640 PP +PP + P +Y V+ PP P K ++ PP + Sbjct: 131 PPYVYSSPPPLYYSP----SPKVYYKSPPPPYVYS-SPPPPYYSPSPKVYYKSPPPPYVY 185 Query: 639 GGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFF 541 P P PPPP P ++ Sbjct: 186 SSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 218 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGG 559 PPP G PPP PPPPPP G Sbjct: 20 PPPPVGVPPQYYPPPPPP---PPPPPPPRKVG 48 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = -2 Query: 672 FFPXFXPPPXFGGGXPXX---PPPXEXGGXXPPPPPP 571 F P PP F G P PPP + PPP P Sbjct: 456 FIPNVMPPGAFPGSIPLNASVPPPTQPPAGEKPPPYP 492 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = -2 Query: 672 FFPXFXPPPXFGGGXPXX---PPPXEXGGXXPPPPPP 571 F P PP F G P PPP + PPP P Sbjct: 456 FIPNVMPPGAFPGSIPLNASVPPPTQPPAGEKPPPYP 492 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = -2 Query: 672 FFPXFXPPPXFGGGXPXX---PPPXEXGGXXPPPPPP 571 F P PP F G P PPP + PPP P Sbjct: 456 FIPNVMPPGAFPGSIPLNASVPPPTQPPAGEKPPPYP 492 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/55 (25%), Positives = 18/55 (32%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFF 541 PP P K + PP + P P G PPPP P ++ Sbjct: 136 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYY 190 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/55 (25%), Positives = 18/55 (32%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFF 541 PP P K + PP + P P G PPPP P ++ Sbjct: 118 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYY 172 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/48 (29%), Positives = 17/48 (35%) Frame = -2 Query: 714 FXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 + + P P + P PPP G P G PPPPP Sbjct: 598 YSTAPVPWGPPVPSYSPYALPPPPPGSYHPVHGQHMPPYGMQYPPPPP 645 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/48 (29%), Positives = 17/48 (35%) Frame = -2 Query: 714 FXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 + + P P + P PPP G P G PPPPP Sbjct: 598 YSTAPVPWGPPVPSYSPYALPPPPPGSYHPVHGQHMPPYGMQYPPPPP 645 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP G PPPPP Sbjct: 71 PPPPSKYGRVYPPPPP 86 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 5/49 (10%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXP-----XXPPPXEXGGXXPPPPP 574 PP P P PPP P PPP PPPPP Sbjct: 114 PPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 >At4g20020.2 68417.m02930 expressed protein Length = 406 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +1 Query: 514 GPPXPFXXXKKXGXXPPXXGGGG--GGXXPPXLXGGGXXXXSPPKXGGG 654 G P F + G PP GGGG G G G +PP GG Sbjct: 212 GGPQNFQRNTQYGQQPPMQGGGGSYGPQQGYATPGQGQGTQAPPPFQGG 260 >At4g20020.1 68417.m02931 expressed protein Length = 419 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +1 Query: 514 GPPXPFXXXKKXGXXPPXXGGGG--GGXXPPXLXGGGXXXXSPPKXGGG 654 G P F + G PP GGGG G G G +PP GG Sbjct: 212 GGPQNFQRNTQYGQQPPMQGGGGSYGPQQGYATPGQGQGTQAPPPFQGG 260 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 28.3 bits (60), Expect = 7.7 Identities = 20/81 (24%), Positives = 26/81 (32%) Frame = -2 Query: 816 PTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFXPPPXFG 637 P K+PP + PP + Y + + PP + PPP Sbjct: 364 PYVYKSPPYVYSSPP-----PYTYSPPP----YAYSPPPPCPDVYKPPPYVYSSPPPYVY 414 Query: 636 GGXPXXPPPXEXGGXXPPPPP 574 P PPP PPPP Sbjct: 415 NPPPSSPPPSPSYSYSSPPPP 435 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = -2 Query: 732 GGXVFFFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 G + F PP P P PPP F G + PPPPPP Sbjct: 350 GLDLLFGSDPPLVYSPPP----PPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPP 399 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,609,186 Number of Sequences: 28952 Number of extensions: 340293 Number of successful extensions: 6837 Number of sequences better than 10.0: 84 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3248 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2236853040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -