BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D05 (964 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 46 3e-05 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 45 9e-05 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 45 9e-05 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 44 1e-04 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 44 2e-04 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 42 5e-04 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 42 6e-04 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 42 6e-04 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 42 8e-04 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 40 0.002 At4g18570.1 68417.m02749 proline-rich family protein common fami... 40 0.002 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 40 0.002 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 40 0.003 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 40 0.003 At1g61080.1 68414.m06877 proline-rich family protein 40 0.003 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 40 0.003 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 39 0.004 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 39 0.004 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 39 0.004 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 39 0.006 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 39 0.006 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 39 0.006 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 39 0.006 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 38 0.008 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 38 0.010 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 38 0.010 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 38 0.013 At3g50180.1 68416.m05486 hypothetical protein 38 0.013 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 38 0.013 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 37 0.017 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 37 0.017 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 37 0.017 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 37 0.017 At1g26150.1 68414.m03192 protein kinase family protein similar t... 37 0.017 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 37 0.023 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 36 0.030 At1g27710.1 68414.m03387 glycine-rich protein 36 0.030 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 36 0.040 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 36 0.040 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 36 0.040 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 36 0.040 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 36 0.040 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 36 0.040 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 36 0.040 At2g05440.2 68415.m00575 glycine-rich protein 36 0.040 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 36 0.040 At1g29380.1 68414.m03592 hypothetical protein 36 0.053 At5g46730.1 68418.m05757 glycine-rich protein 35 0.070 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 35 0.070 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 35 0.093 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 35 0.093 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 35 0.093 At1g75550.1 68414.m08780 glycine-rich protein 35 0.093 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 34 0.12 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 34 0.12 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 34 0.12 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 34 0.12 At3g51290.1 68416.m05614 proline-rich family protein 34 0.12 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 34 0.12 At2g05440.1 68415.m00574 glycine-rich protein 34 0.12 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 34 0.12 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 34 0.12 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 34 0.12 At1g15830.1 68414.m01900 expressed protein 34 0.12 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 34 0.16 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 34 0.16 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 34 0.16 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 34 0.16 At4g01985.1 68417.m00265 expressed protein 34 0.16 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 34 0.16 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 34 0.16 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 33 0.21 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 33 0.21 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 33 0.21 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 33 0.21 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 33 0.21 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 33 0.21 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 33 0.28 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 33 0.28 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 33 0.28 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 33 0.28 At2g30560.1 68415.m03722 glycine-rich protein 33 0.28 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 33 0.37 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 33 0.37 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 33 0.37 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 33 0.37 At5g38560.1 68418.m04662 protein kinase family protein contains ... 32 0.49 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 32 0.49 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 32 0.49 At4g33660.1 68417.m04781 expressed protein 32 0.49 At4g30460.1 68417.m04325 glycine-rich protein 32 0.49 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 32 0.49 At1g70990.1 68414.m08190 proline-rich family protein 32 0.49 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 32 0.65 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 32 0.65 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 32 0.65 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 32 0.65 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 32 0.65 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 32 0.65 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 32 0.65 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 32 0.65 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 32 0.65 At4g00180.1 68417.m00019 axial regulator YABBY3 (YABBY3) identic... 26 0.70 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 31 0.86 At2g05510.1 68415.m00583 glycine-rich protein 31 0.86 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 31 1.1 At3g07560.1 68416.m00903 glycine-rich protein 31 1.1 At1g62240.1 68414.m07021 expressed protein 31 1.1 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 31 1.1 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 28 1.4 At5g10380.1 68418.m01204 zinc finger (C3HC4-type RING finger) fa... 25 1.5 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 31 1.5 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 31 1.5 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 31 1.5 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 31 1.5 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 31 1.5 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 31 1.5 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 31 1.5 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 31 1.5 At1g10620.1 68414.m01204 protein kinase family protein contains ... 31 1.5 At1g02710.1 68414.m00222 glycine-rich protein 31 1.5 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 25 1.8 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 30 2.0 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 30 2.0 At4g16240.1 68417.m02464 hypothetical protein 30 2.0 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 30 2.0 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 30 2.0 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 30 2.0 At3g43583.1 68416.m04636 hypothetical protein 30 2.0 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 30 2.0 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 30 2.0 At1g11850.2 68414.m01364 expressed protein 30 2.0 At1g11850.1 68414.m01363 expressed protein 30 2.0 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 30 2.0 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 26 2.4 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 30 2.6 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 30 2.6 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 30 2.6 At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family... 30 2.6 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 30 2.6 At3g08640.1 68416.m01003 alphavirus core protein family contains... 30 2.6 At3g05220.2 68416.m00570 heavy-metal-associated domain-containin... 30 2.6 At3g05220.1 68416.m00569 heavy-metal-associated domain-containin... 30 2.6 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 30 2.6 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 30 2.6 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 30 2.6 At1g53625.1 68414.m06096 expressed protein 30 2.6 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 30 2.6 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 29 3.5 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 29 3.5 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 29 3.5 At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar... 29 3.5 At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-conta... 29 3.5 At4g34440.1 68417.m04894 protein kinase family protein contains ... 29 3.5 At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family... 29 3.5 At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family... 29 3.5 At4g08230.1 68417.m01358 glycine-rich protein 29 3.5 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 29 3.5 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 29 3.5 At1g76965.1 68414.m08961 glycine-rich protein 29 3.5 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 29 3.5 At1g35880.1 68414.m04457 hypothetical protein 29 3.5 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 29 3.5 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 29 3.5 At3g28630.1 68416.m03573 expressed protein contains Pfam profil... 25 4.2 At3g28630.2 68416.m03574 expressed protein contains Pfam profil... 25 4.3 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 29 4.6 At3g55950.1 68416.m06217 protein kinase family protein contains ... 29 4.6 At3g08630.1 68416.m01002 expressed protein 29 4.6 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 29 4.6 At2g11005.1 68415.m01177 glycine-rich protein 29 4.6 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 29 4.6 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 29 4.6 At1g23540.1 68414.m02960 protein kinase family protein contains ... 29 4.6 At1g15840.1 68414.m01901 expressed protein 29 4.6 At1g04800.1 68414.m00476 glycine-rich protein 29 4.6 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 25 5.2 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 29 6.1 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 29 6.1 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 29 6.1 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 29 6.1 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 29 6.1 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 29 6.1 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 29 6.1 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 29 6.1 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 29 6.1 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 29 6.1 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 29 6.1 At2g05530.1 68415.m00585 glycine-rich protein 29 6.1 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 29 6.1 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 29 6.1 At4g37180.2 68417.m05264 myb family transcription factor contain... 25 7.1 At4g37180.1 68417.m05263 myb family transcription factor contain... 25 7.1 At5g57290.1 68418.m07157 60S acidic ribosomal protein P3 (RPP3B) 28 8.0 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 28 8.0 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 28 8.0 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 28 8.0 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 28 8.0 At4g15460.1 68417.m02363 glycine-rich protein 28 8.0 At4g09270.1 68417.m01535 hypothetical protein same aa sequence a... 28 8.0 At4g09220.1 68417.m01528 hypothetical protein 28 8.0 At3g46740.1 68416.m05074 chloroplast outer envelope protein, put... 28 8.0 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 28 8.0 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 28 8.0 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 28 8.0 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 28 8.0 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 28 8.0 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 28 8.0 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 28 8.0 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 28 8.0 At1g07135.1 68414.m00759 glycine-rich protein 28 8.0 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 25 8.5 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 24 9.6 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP PPP PPPPPPP Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/42 (42%), Positives = 21/42 (50%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP + P P P PPP +PPP + PPPPPPP Sbjct: 420 PPTLTSPPPPSP----PPPVYSPPPPPPPPPPVYSPPPPPPP 457 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP + P P P PP +PPP PPPPPPP Sbjct: 404 PPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPP 445 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P P PPPP PPP PPPPPPP Sbjct: 443 PPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/44 (45%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXX--FXPPPPPPP 776 PP V P P P PPPP +PPP + PPPPPPP Sbjct: 432 PPPVYSPPPPPP---PPPPVYSPPPPPPPPPPPPVYSPPPPPPP 472 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP PPP PPPPPP Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP PPP PPPPPPP Sbjct: 452 PPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 41.5 bits (93), Expect = 8e-04 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPP-XXXXXXXXFXPPPPPPP 776 PP P P P PPP PPP + PPPPPPP Sbjct: 461 PPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Score = 41.5 bits (93), Expect = 8e-04 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP V P P P PPP PPP PPPPP Sbjct: 476 PPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPPP P + PPPPPP Sbjct: 594 PPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP +PPP PPPPP P Sbjct: 490 PPPPVYSPPPPPPPPPPPPVYSPPPPPVYS----SPPPPPSP 527 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP----XXAPPPXXXXXXXXFXPPPPPPP 776 PP V P P P PPPP PPP + PPPP PP Sbjct: 445 PPPVYSPPPPPP--PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P PPP PPP PPPPPP Sbjct: 429 PSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP PPP PPPPP Sbjct: 484 PPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXX----APPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP PPP PPPPPP Sbjct: 497 PPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPP 542 Score = 35.9 bits (79), Expect = 0.040 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 7/49 (14%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPP-------PPXXAPPPXXXXXXXXFXPPPPPPP 776 PP V P P PP PP PP + PPPPPPP Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPP 444 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 P P P P PPPP +PPP PPPP PPP Sbjct: 531 PVYCTRPPPPPPHSPPPPQFSPPPPEPYYYS--SPPPPHSSPPP 572 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +1 Query: 643 FCSPRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 F +P PP +P P P PPP PPPPPP Sbjct: 417 FSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPP 460 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP--PPPP 776 PP P P P PPP +P P PPP PPPP Sbjct: 505 PPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPP 548 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPP-PXXAPPPXXXXXXXXFXPPPPPP 773 P + P P P PPP P +PPP PPPPPP Sbjct: 587 PYLSPPPPPTPVSSPPPTPVYSPPP----PPPCIEPPPPPP 623 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPX----PPPXXPPPLXGXXXFXXFXPPPPPP 774 SP PP +P P PP P P+ + PPPPPP Sbjct: 569 SPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX--PPPPXXAPPPXXXXXXXXFXPPP--PPPP 776 PP P P+P PPPP +PPP PPP PPPP Sbjct: 546 PPPQFSPPPPEPYYYSSPPPPHSSPPPHSP-------PPPHSPPPP 584 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXX--FXPPPPPPP 776 PP P P PPP PPP PPPPP P Sbjct: 554 PPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTP 597 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXX----APPPXXXXXXXXFXPPPPPP 773 P V P P P PPPP +PPP + PPPPP Sbjct: 603 PTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVH--YSSPPPPP 645 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA--PPPXXXXXXXXFXPPPPPPP 776 PP V P P P P P PPP PPPP P Sbjct: 514 PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 SPR P P P PPP P P+ PPP PP Sbjct: 393 SPRPPVVTPLPPPSLPSPPP--PAPIFSTPPTLTSPPPPSPP 432 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 7/49 (14%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX-----PPPPXX--APPPXXXXXXXXFXPPPPPPP 776 PP + P P P PPPP +PPP + PPPPPP Sbjct: 622 PPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPP----PPVYYSSPPPPPP 666 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 PP +P PPP PP + PPPPP Sbjct: 565 PPHSSPPPHSPPPPHSPP----PPIYPYLSPPPPP 595 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 44.8 bits (101), Expect = 9e-05 Identities = 19/42 (45%), Positives = 21/42 (50%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP +PPP + PPPPPPP Sbjct: 528 PPVYSPPPPPPPVHSPPPPVHSPPP-----PPVYSPPPPPPP 564 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/41 (43%), Positives = 20/41 (48%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP V P P P PPPP +PPP + PPP PP Sbjct: 606 PPPVHSPPPPPPVYSPPPPVFSPPP-SQSPPVVYSPPPRPP 645 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/45 (44%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 PP V P P P PPPP +PPP + PPPP PPP Sbjct: 590 PPPVHSPPPPAPVHSPPPPVHSPPP----PPPVYSPPPPVFSPPP 630 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P P PPPP +PPP PPPP Sbjct: 553 PPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPP 592 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP +PPP PPPP P Sbjct: 560 PPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXP--PPPPPP 776 P P P PPPP +PPP P PPPPP Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXX--FXPPPPPPP 776 +F P P P PPPP +PPP PPPPPP Sbjct: 572 VFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPP 617 Score = 34.7 bits (76), Expect = 0.093 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA----PPPXXXXXXXXFXPPPP---PPP 776 PP P P PPPP + PPP F PPPP PPP Sbjct: 536 PPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPP 584 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P K PP P +PPP + PPPPPPP Sbjct: 511 PVTKRRSPPPAPVNSPPP------PVYSPPPPPPP 539 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP----PPPPP 776 P V P P PPPP +PPP PP PPP P Sbjct: 599 PAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRP 644 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 652 PRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 P PP P PPP PP + PPP PP Sbjct: 606 PPPVHSPPPPPPVYSPPPPVFSPP-PSQSPPVVYSPPPRPP 645 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP +PPP PPPPPP Sbjct: 580 PPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P P PPPP +PPP PPPP Sbjct: 530 PPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P P PPPP +PPP PPPP Sbjct: 610 PPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPP 649 Score = 41.5 bits (93), Expect = 8e-04 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP V P P P PPPP PP + PPPPPP Sbjct: 495 PPPVHSPPPPSPIHSPPPPPVYSPP---PPPPVYSPPPPPP 532 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P PPPP +PPP PPPPP Sbjct: 617 PPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPPP +PPP PPPPP Sbjct: 552 PPPPVHSPPP-PVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P PPPP +PPP PPPP Sbjct: 603 PPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPP 642 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 8/50 (16%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA-----PPPXXXXXXXXFXPPPP---PPP 776 PP V P P P PPPP PPP PPPP PPP Sbjct: 512 PPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPP 561 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/43 (41%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPX--XXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPPP +PPP + PPPPPP Sbjct: 503 PPSPIHSPPPPPVYSPPPPPPVYSPPP----PPPVYSPPPPPP 541 Score = 36.3 bits (80), Expect = 0.030 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP V P P PPPP +PPP PPPPP Sbjct: 626 PPPVFSPPPP--VHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P PPPP +PPP PPPP Sbjct: 537 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P PPPP +PPP PPPP Sbjct: 573 PPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Score = 34.7 bits (76), Expect = 0.093 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA---PPPXXXXXXXXFXPPPP---PPP 776 PP V P P PPPP + PPP F PPPP PPP Sbjct: 596 PPPVHS--PPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPP 641 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 PP P P PPP PPP PPPP PPP Sbjct: 545 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPP 589 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P PPP PPP PPPPP Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 672 PXPKPXXXPPP--PXXAPPPXXXXXXXXFXPPPPPP 773 P P P PPP P +PPP + PPPPPP Sbjct: 493 PPPPPVHSPPPPSPIHSPPP-----PPVYSPPPPPP 523 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +3 Query: 696 PPPPXXAPPPXXXXXXXXFXP---PPPPPP 776 PPPP +PPP P PPPPPP Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPP 523 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P PPP PPP PPPP Sbjct: 559 PPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P PPP PPP PPPP Sbjct: 566 PPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPP 605 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP +PPP P PP Sbjct: 639 PPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPP 680 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 6/47 (12%) Frame = +1 Query: 652 PRXXGGPPXQNPXXPXPPPX-----XPPPLXG-XXXFXXFXPPPPPP 774 P PP +P PPP PPP+ + PPPPPP Sbjct: 495 PPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP PPP P PPPPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP PPP PPPPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP PPP PPPP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP PPP PPP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 646 CSPRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 CSP PP P P PPP PPP P PPPP Sbjct: 374 CSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAP-PPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP P PP + PPPPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 666 GXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 G P P PPPP PPP PPPPPPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPP--PPPPPPPP 407 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 SP PP P P PPP PPP + PPPPPP Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPP-PPPPPYVYPSPPPPPP 418 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXX--FXPPPPPPP 776 PP P P PPPP +PPP PPPP PP Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPP 441 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP PPP PPPPP P Sbjct: 413 PPPPPPSPPPYVYPPPPPPYVYPPP---PSPPYVYPPPPPSP 451 Score = 34.7 bits (76), Expect = 0.093 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP---PPPPP 776 PP V P P P PPP PPP PP PPPPP Sbjct: 406 PPYVYPSPPPPP-PSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 ++P P P P PPPP P + PPPP P Sbjct: 409 VYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSP 451 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 LFP P P P PPPP PPP PPPPPP Sbjct: 37 LFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXF-----XPPPPPP 773 PP P P P PPPP PPP PPPPPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 11/53 (20%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA-----------PPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP A PPP PPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQP 96 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +3 Query: 651 PPXVXGX--PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P PPP PPP PPPP Sbjct: 78 PPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPP 119 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP G K PPPP PPP PPPPPPP Sbjct: 624 PPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/42 (45%), Positives = 21/42 (50%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP + P P+P PPPP PPP PPPPPPP Sbjct: 588 PPPLAQPPPPRPP--PPPP---PPPSSRSIPSPSAPPPPPPP 624 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPP PPP PPPPPPP Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPP------PPPPPPP 607 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 682 NPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 +P P PPP PP F PPPPPP Sbjct: 500 SPSQPPPPPPPPPLFMSTTSFSPSQPPPPPP 530 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 682 NPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 +P P PPP PP F PPPPPP Sbjct: 521 SPSQPPPPPPPPPLFTSTTSFSPSQPPPPPP 551 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +1 Query: 694 PXPPPXXPPPLX-GXXXFXXFXPPPPPP 774 P PPP PPPL F PPPPPP Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPP 509 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P PK P APPP PPPPPPP Sbjct: 686 PPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPP 720 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PP P PPPP PPP F P PPPP L Sbjct: 511 PPLFMSTTSFSPSQPPPPP---PPPPLFTSTTSFSPSQPPPPPPL 552 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 682 NPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 +P P PPP PP PPPPPP Sbjct: 614 SPSAPPPPPPPPPSFGSTGNKRQAQPPPPPP 644 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPP--XXXXXXXXFXPPPPPPP 776 PP P P PPP PPP PPPPPPP Sbjct: 604 PPPPSSRSIPSPSAPPPP--PPPPPSFGSTGNKRQAQPPPPPPP 645 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP--PPPPP 776 PP P PPPP PPP PP PPPPP Sbjct: 643 PPPPPPTRIPAAKCAPPPPP--PPPTSHSGSIRVGPPSTPPPPP 684 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPP-PPXX----APPPXXXXXXXXFXPPPPPP 773 PP PKP PP PP APPP PPPPP Sbjct: 687 PPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPP 732 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P PP P P PPPPPP Sbjct: 681 PPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPP 721 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP + P P PPPPP Sbjct: 705 PPSSTRLGAPPP---PPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P K PPPP P PPP PPP Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPP 601 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 684 PXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P PPPP PPP PP PPP Sbjct: 676 PPSTPPPP--PPPPPKANISNAPKPPAPPP 703 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 8/50 (16%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP--------PPPPP 776 PP + P P P P PPP PP PPPPP Sbjct: 719 PPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPP 768 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP +PPP PPPPPPP Sbjct: 1095 PPAALFPPLPPPPSQPPPPPLSPPPSP--------PPPPPPP 1128 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP--PPPP 776 PP P P P P PP PPP PPP PPPP Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPP 1113 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPX----XAPPPXXXXXXXXFXPPPPPPP 776 P P P PPPP PPP PPP PPP Sbjct: 1079 PPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPP 1123 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXP----PPPXXA------PPPXXXXXXXXFXPPPPPPP 776 PP P P P P PPP A PPP PP PPPP Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP 1124 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 678 PKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 P P PP P +PPP P PP PP L Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSL 1091 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPP----PXXXXXXXXFXPPPPPPP 776 PP P P P P PP +PP PP PPPP Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPP 1107 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPP 725 LFPP P P PPP PPP Sbjct: 1099 LFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 41.9 bits (94), Expect = 6e-04 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP PP PPPPPPP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 6/47 (12%) Frame = +3 Query: 654 PXVXGXPXPKPXXXP------PPPXXAPPPXXXXXXXXFXPPPPPPP 776 P + P P P P PPP PPP PPPPPPP Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 PP V P P PPPP +PPP PPPP PPP Sbjct: 560 PPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPP 604 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/45 (44%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 PP V P P P PPPP +PPP + PPPP PPP Sbjct: 603 PPPVFSPPPPSPVYSPPPPSHSPPP------PVYSPPPPTFSPPP 641 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 PP V P P PPP +PPP PPP PPPP Sbjct: 553 PPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPP 597 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 PP P P PPPP PP F PPPP PPP Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPP 611 Score = 36.3 bits (80), Expect = 0.030 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP V P P P PPP PPP PPPP P Sbjct: 576 PPPVASPPPPSP---PPPVHSPPPPPVFSPPPPVFSPPPPSP 614 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P PP P +PPP PPPP Sbjct: 596 PPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPP 635 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 6/47 (12%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPP---XXXXXXXXFXPPPP---PPP 776 P + P P PPPP +PPP + PPPP PPP Sbjct: 538 PPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPP 584 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXX--FXPPPPP 770 PP P P P PPPP +PPP PPPP Sbjct: 587 PPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPP 628 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPP--XXXXXXXXFXPPPPPPP 776 PP P P PPP +PPP PPPP PP Sbjct: 545 PPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPP 588 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP 767 PP P P P PPPP +PPP P P Sbjct: 618 PPPPSHSPPP-PVYSPPPPTFSPPPTHNTNQPPMGAPTP 655 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 P PK PP P P + PPPP PPP Sbjct: 524 PPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPP 561 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPP-PXXXXXXXXFXPPPP----PPP 776 PP V P P PP P +PP P PPPP PPP Sbjct: 525 PPKVEDTRVPPPQ--PPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPP 569 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP-PXXAPPPXXXXXXXXFXPPPPPPP 776 PP V P P P PPP P +PPP PPPP P Sbjct: 515 PPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSP 557 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 +PP P P P PP PPP PPPP P Sbjct: 560 YPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSP 602 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 +PP P P P PP PPP PPPP P Sbjct: 575 YPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSP 617 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 +PP P P P PP PPP PPPP P Sbjct: 620 YPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662 Score = 36.7 bits (81), Expect = 0.023 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX--PPPPXX--APPPXXXXXXXXFXPPPPPPP 776 PP V P P P PPPP +PPP PP PPPP Sbjct: 487 PPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPP 532 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 +PP P P P PP PPP PPPP Sbjct: 635 YPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPP 675 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P P P P PP PPP PPPP P Sbjct: 545 YAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSP 587 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 +PP P P P P PPP PPPP P Sbjct: 590 YPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSP 632 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 +P P P P PP PPP PPPP P Sbjct: 605 YPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 647 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPP----XXXXXXXXFXPPPPPP 773 PP P + PPPP +PPP + PPPPP Sbjct: 444 PPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPP 488 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 8/50 (16%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXX--------APPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP PPP PPPP P Sbjct: 523 PPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSP 572 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP-----PPPPP 776 PP P PPPP +P P PP PPPPP Sbjct: 442 PPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPP 488 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPX--XAPPPXXXXXXXXFXPPPPPP 773 PP P P PPPP +PPP + PPPPP Sbjct: 460 PPPSPSPPPPYVYSSPPPPYVYSSPPP----PPYVYSSPPPPP 498 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/39 (30%), Positives = 13/39 (33%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP 764 +PP P P P P PPP PPP Sbjct: 650 YPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPP 688 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PP P P P PPP PPP PPPPPPP L Sbjct: 303 PPPQKSIPPPPPPP-PPPLLQQPPPPPSVSKAPPPPPPPPPPKSL 346 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 P V P P P PPPP +PPP PPPP Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPP 680 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P P PPPP +PPP PPPP Sbjct: 677 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 716 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P P PPPP +PPP PPPP Sbjct: 759 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 798 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P PPPP +PPP PPPPP Sbjct: 648 PPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPPP +PPP PPPPP Sbjct: 699 PPPPVHSPPP-PVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP +PPP PPPP P Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPPP +PPP PPPP Sbjct: 744 PPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPP 784 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP--XXAPPPXXXXXXXXFXPPPPP 770 PP V P P P PPPP PPP PPPP Sbjct: 736 PPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 36.3 bits (80), Expect = 0.030 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPP 725 PP V P P P PPPP +PPP Sbjct: 796 PPPVHSPPPPSPIYSPPPPVFSPPP 820 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P PPPP +PPP PPPP Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P PPPP +PPP PPPP Sbjct: 752 PPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 791 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P PPPP +PPP PPPP Sbjct: 670 PPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 709 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPPP +PPP F PPPP P Sbjct: 713 PPPPVHSPPP-PVHSPPPPVQSPPP-----PPVFSPPPPAP 747 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P PPPP +PPP + PPPPP Sbjct: 720 PPPPVHSPPPPVQSPPPPPVFSPPP----PAPIYSPPPPP 755 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP---XXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPPP PPP PPPPP Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 PP P P PPP PPP PPPP PPP Sbjct: 692 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPP 736 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 8/50 (16%) Frame = +3 Query: 651 PPXVXGXP-----XPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 PP V P P P PPPP +PPP + PPPP PPP Sbjct: 775 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPP----PSPIYSPPPPVFSPPP 820 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPP PPP PPPP P Sbjct: 706 PPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAP 747 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPPP +PPP PPPP Sbjct: 663 PPPPMHSPPP-PVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P PP P +PPP F PPP P Sbjct: 789 PPPVHSPPPPVHSPPPPSPIYSPPPPV------FSPPPKP 822 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P PPP PPP PPPP Sbjct: 657 PPPVFSPPPPM-HSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPP 771 PP +P P P PP + PPPPP Sbjct: 722 PPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +3 Query: 696 PPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 PPPP +PPP F PPPP PPP Sbjct: 649 PPPPVHSPPPPV------FSPPPPMHSPPP 672 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXP 665 GGGGGGG N GGG GGGG G G G P Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGGGGGG-GGGPP 141 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXP 665 GGGGGGG N GGG GGGG G G G P Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGGGGGG-GGGPP 141 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGG----AXXGGGGXXXGFGXG 671 GGGGGG GGG GGGG G G G Sbjct: 313 GGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGG 350 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PP APPP PPPPPPP Sbjct: 527 PPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 F P P P P P APPP PPPPPPP Sbjct: 500 FKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPP 542 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PP APPP PPPPPPP Sbjct: 514 PPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 696 PPPPXXAPPPXXXXXXXXFXPPPPPP 773 PPPP PPP F PPPPPP Sbjct: 454 PPPPPPPPPPPAVMPLKHFAPPPPPP 479 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA---PPPXXXXXXXXFXPPPPPPP 776 PP P PPPP A PPP PPPPPPP Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 36.3 bits (80), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA---PPPXXXXXXXXFXPPPPPPP 776 PP P PPPP A PPP PPPPPPP Sbjct: 525 PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PP P P P +PPP PPPPPPP L Sbjct: 555 PPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPL 599 Score = 35.5 bits (78), Expect = 0.053 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 700 PPPXXPPPLXGXXXFXXFXPPPPPP 774 PPP PPP F PPPPPP Sbjct: 455 PPPPPPPPPPAVMPLKHFAPPPPPP 479 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP PPP PPPPPPP Sbjct: 508 PPPPPPPPLPTTIAAPPPPP--PPPRAAVAP----PPPPPPP 543 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 F P P KP PP PPP PPPPPPP Sbjct: 490 FAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAA--PPPPPPPP 530 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P PPPP PP F PPPP PP Sbjct: 459 PPPPPPAVMPLKHFAPPPPPPLPPAVMPLKH--FAPPPPTPP 498 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PP APPP P PPP P Sbjct: 542 PPGTAAAPPPPPP--PPGTQAAPPPPPPPPMQNRAPSPPPMP 581 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 645 LFPPXVXGXPXP-----KPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 LFPP P P K P P PP PPPPPPP Sbjct: 414 LFPPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPP 462 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P P PPP PPPPPPP Sbjct: 577 PPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP + P PPPP PP PPPPPP Sbjct: 477 PPPLPPAVMPLKHFAPPPP--TPPAFKPLKGSAPPPPPPPP 515 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +1 Query: 670 PPXQNPXX-PXPPPXXPPPLXGXXXFXXFXPPPPPPXK 780 PP P PPP PPPL PPPPPP + Sbjct: 497 PPAFKPLKGSAPPPPPPPPLPTTIAAP---PPPPPPPR 531 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXF---XPPPPPPP 776 P P P P APPP PPPPPPP Sbjct: 477 PPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPP 514 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 P P P P PPP PPPPP Sbjct: 594 PPPMPLANGATPPPPPPPMAMANGAAGPPPPPP 626 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P+P PPPP PPP PPPP PP Sbjct: 47 PPSPSPEPEPEPADCPPPP--PPPPCPPPPSPPPCPPPPSPP 86 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PP P +PPP PP PP P Sbjct: 67 PPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP--PPPXXL 785 P P P PPPP +PPP PPPP PPP L Sbjct: 63 PPPPPPPCPPPP--SPPPCPPPPSPPPSPPPPQLPPPPQL 100 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P P PPPP PPP P PP P Sbjct: 81 PPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPP-PPXXAPPPXXXXXXXXFXP--PPPPPP 776 PP P P P PP PP +PPP P PPP PP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPP--PPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PP P P P PP PP PPP P P PP L Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDL 117 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +3 Query: 672 PXPKPXXXP-PPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P P P P P PPP PPP PPP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPC---PPPPSPPP 78 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/44 (43%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP--PP 776 PP V P P PPPP +PPP + PPPPP PP Sbjct: 56 PPPVYSRPVAFP---PPPPIYSPPPPPIYPPPIYSPPPPPIYPP 96 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP--PPPP 776 P P P PPPP PPP PPP PPP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPP 103 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP--PP 776 PP P P P PPP +PPP + PPP P PP Sbjct: 68 PPPPIYSPPPPPIY--PPPIYSPPPPPIYPPPIYSPPPTPISPP 109 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP--PPP 776 FPP P P PPP PPP PP P PPP Sbjct: 66 FPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 9/41 (21%) Frame = +3 Query: 681 KPXXXPPPPXXA------PPPXXXXXXXXFXPPPP---PPP 776 +P PPPP PPP F PPPP PPP Sbjct: 37 QPIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPP 77 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P PPPP P PPPPP Sbjct: 46 PYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPP 79 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 3/38 (7%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 P P P P PPP PPP PPPP Sbjct: 54 PPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPP 91 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPP APPP PPPPPPP Sbjct: 375 PPGPANQTSPPPP--PPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPXPPPXX--PPPLXGXXXFXXFXPPPPPPXK 780 +P GP Q P PPP PPP PPPPPP K Sbjct: 371 APPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGK 416 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P APPP PPPPPP Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PP A PP PPPPPP Sbjct: 388 PPPSAAAPPPPP---PPKKGPAAPPPPPPPGKKGAGPPPPPP 426 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P P PPPP PPP + PPPPP Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPP--PKKVSSYCPPPPP 97 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = +1 Query: 646 CSPRXXGGPPXQNPXXPXPPP--XXPPPL---XGXXXFXXFXPPPPP 771 CSP PP +P P PPP PPP + PPPPP Sbjct: 51 CSPSCIQNPPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 678 PKPXXXPPPPXXAPPPXXXXXXXXFXPP--PPPPP 776 P PPPP +PPP PP PPPPP Sbjct: 53 PSCIQNPPPP--SPPPPSPPPPACPPPPALPPPPP 85 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 F P P P P PPPP P P PPPPP P Sbjct: 49 FSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXP--KPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP +PP PPPP P Sbjct: 27 PPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSP 70 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P PPPP +PP F PP PPP Sbjct: 25 PPPPSHISPPPPPFSPP--HHPPPPHFSPPHQPPP 57 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P P P P PPP +PPP F PP PPP Sbjct: 11 YSPPSHQHPLPSP-VPPPPSHISPPP------PPFSPPHHPPP 46 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P PPPP PPP PPPP P Sbjct: 131 PPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTP 171 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP PP PPPPP P Sbjct: 130 PPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTP 171 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP PP PPPPP P Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPP----PPPTVKPPPPPTP 127 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPPP PP + PPPP P Sbjct: 98 PPPPTVKPPPPPYVKPPPPPTVKPP---PPPTPYTPPPPTP 135 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP---PXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPP P PPP PPPPP Sbjct: 106 PPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP V P P PPPP PP + PPPPP Sbjct: 63 PPTVK--PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPP 101 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP V P P PPP PPP P PPPP Sbjct: 100 PPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA---PPPXXXXXXXXFXPPPPPP 773 PP V P P P PPPP PPP PPPPP Sbjct: 84 PPTVK--PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP V P P PPP PPP P PPPP Sbjct: 92 PPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPPP P PPPP P Sbjct: 138 PPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP----PPPP 776 PP P P PPPP PPP P P PPPP Sbjct: 123 PPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPP 168 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 PP P P PPP PPP PPP PPPP Sbjct: 132 PPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 P P PPP PPP PPPPP Sbjct: 61 PKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPP 93 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPX---XXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PP P PPP PPPP P Sbjct: 114 PPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 7/48 (14%) Frame = +3 Query: 651 PPXVXGXPXP---KPXXXPPPP----XXAPPPXXXXXXXXFXPPPPPP 773 PP + P P KP PPP PPP + PPPPP Sbjct: 70 PPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPP 117 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P PP PPP PPPPP Sbjct: 69 PPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPP 109 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 4/37 (10%) Frame = +3 Query: 678 PKPXXXPPPPXXAPPPXXXXXXXXFXPPPP----PPP 776 PK PP P PP PPPP PPP Sbjct: 42 PKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPP 78 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP---PPPPP 776 PP V P P P PPP +PPP PP PPPPP Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPP--PPXXAPPPXXXXXXXXFXPPP-----PPPP 776 PP V P P PP PP +PPP PPP PPPP Sbjct: 421 PPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPP 469 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 SP PP P P PPP PP F PPP PP Sbjct: 404 SPPIVALPPPPPPSPPLPPPVYSPP----PSPPVFSPPPSPP 441 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P PPPP +PP + PPP PP Sbjct: 403 PSPPIVALPPPPPPSPP----LPPPVYSPPPSPP 432 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P P PPP PPP + PPPPPPP Sbjct: 22 PPPPPPSLPPP---VPPPPPSHQPYSYPPPPPPPP 53 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 6/48 (12%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPP------PXXXXXXXXFXPPPPPPP 776 PP P +P PPPP P P PPPPPPP Sbjct: 31 PPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPP 78 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PP G P P P PPP PPP PPPPPPP L Sbjct: 672 PPLPGGGPPPPP----PPPGGGPPPPPGGG----PPPPPPPPGAL 708 Score = 33.9 bits (74), Expect = 0.16 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 7/48 (14%) Frame = +1 Query: 652 PRXXGGP-----PXQNPXXPX--PPPXXPPPLXGXXXFXXFXPPPPPP 774 PR GG P P P PPP PPP G PPPPPP Sbjct: 656 PRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 612 PPPPPPGGG 586 PPPPPPGGG Sbjct: 681 PPPPPPGGG 689 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPK--PXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP + P P P PPPP PPP P P PPP Sbjct: 107 PPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPP 150 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 PP P P PPPP PP PPPP PPP Sbjct: 89 PPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPP 133 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP PP P P PPP Sbjct: 56 PPTFQPAP-PANDQPPPPPQSTSPPPVATTPPALPPKPLPPP 96 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP 764 L PP P P P PPPP PP PPP Sbjct: 97 LSPPQTT--PPPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPP-PPXXAPPPXXXXXXXXFXPP---PPPPP 776 PP P P P PP PPP PP PPPPP Sbjct: 71 PPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPP 116 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 666 GXPXPKPXXXPP-PPXXAPPPXXXXXXXXFXPPPPP 770 G P P+P PP PP P P PPPPP Sbjct: 43 GPPPPQPDPQPPTPPTFQPAPPAND-----QPPPPP 73 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P + P P PPPP PPP PP PP Sbjct: 258 PTISPPPLPPQTLKPPPPQTTPPP-----PPAITPPLSPP 292 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P P PPPP PP PPPPPP Sbjct: 151 PPPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPP 185 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXF---XPPPPPPP 776 P P P PPPP PP PPPPPPP Sbjct: 120 PPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPP 157 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 5/30 (16%) Frame = +1 Query: 700 PPPXXPPPLX-----GXXXFXXFXPPPPPP 774 PPP PPPL G PPPPPP Sbjct: 97 PPPPPPPPLSAITTTGHHHHRRSPPPPPPP 126 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPP 771 P P P PPP PPP + + PPPPP Sbjct: 41 PVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPPXK 780 PP +P PPP PPP PPPPP K Sbjct: 40 PPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSK 76 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P PPP PP + PPPPP Sbjct: 39 PPPVYSPPISPPPPPPPP----PPQSHAAAYKRYSPPPPP 74 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 672 PXPKPXXXPP--PPXXAPPPXXXXXXXXFXPPPPPPP 776 P P P PP PP PPP + PPPP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPP 73 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 655 RXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPP 765 R PP Q P P PPP PPP G PPP Sbjct: 20 RRQRAPPPQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 699 PPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PPP PPP PPPPPPP L Sbjct: 25 PPPQPPPPPP---------PPPPPPPPRL 44 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 P P+P PPPP PPP PPP Sbjct: 25 PPPQPPPPPPPP-PPPPPPRLGPRLRLRLLPPP 56 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P PPPP +PPP + PPPP P Sbjct: 513 PPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 554 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 ++ P V P P P PP PPP PPPP P Sbjct: 681 VYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSP 723 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 ++ P V P P P P PPP PPPPPP Sbjct: 638 VYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPP 680 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P V P P P PPP PPP P PPPP Sbjct: 522 PSVRAYPPPPPLSPPPP--SPPPPYIYSSPPPPSPSPPPP 559 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP--XXAPPPXXXXXXXXFXPPPP 767 PP + P P P PPPP +PPP PPPP Sbjct: 542 PPYIYSSPPP-PSPSPPPPYIYSSPPPVVNCPPTTQSPPPP 581 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 660 VXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 V P P P PP PPP PPPPP Sbjct: 629 VQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPP 665 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P PP +PPP PPPPP Sbjct: 632 PPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPP 665 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P PP +PPP PPPPP Sbjct: 675 PPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPP 708 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 + P P P P PP PP PPPPP Sbjct: 668 YSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPP 708 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 P P P P PP PPP PPPP Sbjct: 713 PVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPP 751 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPX---XAPPPXXXXXXXXFXPPPPPPP 776 PP P K PPPP +PPP PPPPP Sbjct: 488 PPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPP 532 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 ++ P V P P P P PPP PPPP P Sbjct: 695 VYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSP 738 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/43 (30%), Positives = 14/43 (32%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 +PP P P P PP PPP P PP Sbjct: 726 YPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPP 768 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +3 Query: 696 PPPPXX----APPPXXXXXXXXFXPPPPPPP 776 PPPP +PPP PPPPPP Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPP 637 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP 767 PP P PK P P P P PPPP Sbjct: 572 PPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPP 610 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXX-----APPPXXXXXXXXFXPPPPPPP 776 PP P P+ P P +PPP PPPPPPP Sbjct: 580 PPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQS--PPPPPPP 624 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXX----APPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP +PPP PPPPP Sbjct: 609 PPTYYATQSPPP---PPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 651 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP----PPPPP 776 PP V P + PPP P + PP PPPPP Sbjct: 663 PPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPP 708 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP--PXXAPPPXXXXXXXXFXPPPPPPP 776 PP + P P PPP APPP PPPPPPP Sbjct: 19 PPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPP 62 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 6/36 (16%) Frame = +3 Query: 684 PXXXPPPPXXA------PPPXXXXXXXXFXPPPPPP 773 P PPPP PPP PPPPPP Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPP 49 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 651 PPXVXGXPX-PKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P PKP PPP PPP PP P PP Sbjct: 141 PPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPP 183 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PP PPP PP P PP Sbjct: 124 PPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPP 165 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP PKP PPP PP PP P P Sbjct: 130 PPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTP 170 Score = 28.7 bits (61), Expect = 6.1 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 8/50 (16%) Frame = +3 Query: 651 PPXVXGXPXP---KPXXXPP---PPXXAPP--PXXXXXXXXFXPPPPPPP 776 PP V P P KP PP PP PP P PP PPP Sbjct: 76 PPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPP 125 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 37.1 bits (82), Expect = 0.017 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 PP V P P PPPP +PPP PPP PPPP Sbjct: 46 PPPVKSPPPPYEYKSPPPPVKSPPPPYYYHS---PPPPVKSPPPP 87 Score = 36.7 bits (81), Expect = 0.023 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 PP V P P PPPP +PPP PPP PPPP Sbjct: 78 PPPVKSPPPPYVYSSPPPPVKSPPPPYYYHS---PPPPVKSPPPP 119 Score = 36.7 bits (81), Expect = 0.023 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPPXXL 785 PP V P P PPPP +PPP PPPP PPP L Sbjct: 142 PPPVKSPPPPYYYHSPPPPVKSPPP----PYYYHSPPPPVKSPPPPYL 185 Score = 36.3 bits (80), Expect = 0.030 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 PP V P P PPPP +PPP PPP PPPP Sbjct: 110 PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHS---PPPPVKSPPPP 151 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P PPPP +PPP + PPPP Sbjct: 174 PPPVKSPPPPYLYSSPPPPVKSPPP----PVYIYASPPPP 209 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 P P PPPP +PPP PPP PPPP Sbjct: 37 PPPYEYKSPPPPVKSPPPPYEYKS---PPPPVKSPPPP 71 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP--XXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP +PPP + PPPP Sbjct: 37 PPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPP 80 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 PP V P P PPPP PP PPP PPPP Sbjct: 62 PPPVKSPPPPYYYHSPPPP-VKSPPPPYVYSS--PPPPVKSPPPP 103 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 PP V P P PPPP PP PPP PPPP Sbjct: 94 PPPVKSPPPPYYYHSPPPP-VKSPPPPYYYHS--PPPPVKSPPPP 135 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 PP V P P PPPP PP PPP PPPP Sbjct: 126 PPPVKSPPPPYYYHSPPPP-VKSPPPPYYYHS--PPPPVKSPPPP 167 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 PP V P P PPPP PP PPP PPPP Sbjct: 158 PPPVKSPPPPYYYHSPPPP-VKSPPPPYLYSS--PPPPVKSPPPP 199 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 +FPP + P PPP PPP PP PPPP L Sbjct: 102 VFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDE--SPPAPPPPEQL 146 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP + P P P PPP PP F PP PP Sbjct: 70 PPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPP 111 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP--PPP 776 PP V P PPP +PPP PPPP PPP Sbjct: 55 PPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPP 98 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 PP V P P PPPP PP PP P PPP Sbjct: 62 PPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPP 106 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPX--XXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPP + PP PPPPP Sbjct: 30 PPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPP 72 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 651 PPXVXGXPX-PKPXXXPPP-PXXAPPPXXXXXXXXFXPPPPP 770 PP + P P P PPP P PPP PPPP Sbjct: 80 PPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPP 121 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXP---PPPXXAPPPXXXXXXXX--FXPPPPPP 773 L PP P P P PPP +PPP PPPPP Sbjct: 83 LTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPP 130 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P + P P+P PP P APPP PPPPP Sbjct: 87 PTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPP 128 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP--PXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPP P +PPP PPPPPP Sbjct: 94 PPPEPSPPPPLPTEAPPPANPVSSPPPES-------SPPPPPP 129 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPP--PXXXXXXXXFXPPPPPPPXXL 785 P P P+ PPPP APP P PPPP P L Sbjct: 111 PANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSL 157 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 SP G PP P P P P PPPL PPP Sbjct: 79 SPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPP 120 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPPP P P PPPP Sbjct: 109 PPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPP 150 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PP P PP P PPPP Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPP 103 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP--PPPPXXL 785 PP P P P PP PPP PP P PP L Sbjct: 126 PPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKL 172 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 P PKP P P + PP PP PP Sbjct: 266 PPPKPSPDPLPSNSSSPPTLLPPSSVVSPPSPP 298 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 696 PPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PPPP APP PPPPPPP Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPP 733 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP + KP PPP PPP PPPPP P Sbjct: 674 PPPISNSDK-KPALPRPPPPPPPPPMQHSTVTKVPPPPPPAP 714 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP + K PPP APP PPPPPPP Sbjct: 695 PPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPP 736 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P PPP APPP PPPPPP Sbjct: 754 PPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPP 795 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 P V P P PPPP P PP PP P L Sbjct: 720 PIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRL 763 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P PPPP APP PP PP Sbjct: 717 PPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPP 758 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPXPPP--XXPPPLXGXXXFXXFXPPPPP 771 SP PP PPP PPP G PPPPP Sbjct: 753 SPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPP 795 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 36.3 bits (80), Expect = 0.030 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +3 Query: 645 LFPPXVXGXPX---PKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 LFPP P P P PPP PPP PPPPPP Sbjct: 62 LFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPP 108 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP V P PPP +PP F P PP PP Sbjct: 30 PPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPP 71 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 678 PKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P PPP PP PPPPPPP Sbjct: 82 PPPLPRLPPPLLPPPEEPPRE----PPPPPPPP 110 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP--PPPP 773 PP P P PP P PP PP PPPP Sbjct: 42 PPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPP 84 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP + P PPP + PP PP PP P Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLP 70 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 36.3 bits (80), Expect = 0.030 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 GGGG GG GG+ GGGG G+G G T G K Sbjct: 168 GGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGGVSTKGSGK 211 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG GGGG GGG GGG G G G + G Sbjct: 150 GGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSG 191 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGG-GXXXGFGXG 671 GGGG G GGG GGG G G+G G Sbjct: 108 GGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSG 143 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G G GGG G G GGGG G G G GG Sbjct: 139 GYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGG 180 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = -1 Query: 775 GGGG---GGGXXNXXXXXXXGGGAXXGGG---GXXXGFGXGXPXTXGG 650 GGGG GGG GGGA G G G G G G P G Sbjct: 115 GGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSG 162 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP P PPPPPPP Sbjct: 15 PPMRGRVPLPPP---PPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PP + P P P PPP PPPPPPP L Sbjct: 619 PPRLVCGPYPLPRLVRVGSPSPPPPSMSGGA----PPPPPPPPML 659 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 35.9 bits (79), Expect = 0.040 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP----XXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP PPP PPPPPP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP-----PXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPP P PPP PPPPPPP Sbjct: 30 PPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPP 76 Score = 32.7 bits (71), Expect = 0.37 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA----PPPXXXXXXXXFXPPPPPPPXXL 785 PP P P P PPPP PPP P PPPPP L Sbjct: 32 PPMRRRAPLPPP---PPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPL 77 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 678 PKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 P PPPP PPP PPPPPPP L Sbjct: 4 PSKRRPPPPP---PPPPRLLVLPPLPPPPPPPPPQL 36 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PPPP P P PPPP P Sbjct: 84 PPPTPSVPSPTPPVSPPPP--TPTPSVPSPTPPVSPPPPTP 122 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP--PPPP 776 PP P P P P P +PPP PP PPPP Sbjct: 95 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 138 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP--PPPP 776 PP P P P P P +PPP PP PPPP Sbjct: 113 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 156 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P P PPPP P P PPPP P Sbjct: 102 PTPTPSVPSPTPPVSPPPP--TPTPSVPSPTPPVSPPPPTP 140 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P P PPPP P P PPPP P Sbjct: 120 PTPTPSVPSPTPPVSPPPP--TPTPSVPSPTPPVSPPPPTP 158 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P P P PPPP P P P PPP Sbjct: 138 PTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPP 179 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P V P P PP PPP PP PPP Sbjct: 79 PPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 119 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P P P P +PPP PP P Sbjct: 131 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVP 170 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG GGGG GGG GGGG G+G GG Sbjct: 585 GGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 Query: 776 WGGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXG 672 +GGGGGG GGG GGG G G + G Sbjct: 587 YGGGGGGYGGGGGYG---GGGGYGGGGGYGGGYGG 618 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP---PPPPP 776 PP V P P PPP +PPP PP PPP P Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP--PPP 776 P P PPP APPP PPP PPP Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPP 72 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP V P PPP APPP PP PPP Sbjct: 45 PPPVSAPPPVTTS--PPPVTTAPPPANPPPPVSSPPPASPPP 84 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPP PPP PPP PP Sbjct: 66 PPANPPPPVSSPPPASPPP-ATPPPVASPPPPVASPPPATPP 106 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PP P P PPP PPP P PPP L Sbjct: 72 PPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPL 116 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +3 Query: 651 PPXVXGXPXP--KPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P P PPP PPP P P P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 P P P PPP PPP PPP PPP Sbjct: 31 PAP-PTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPP 67 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXP----KPXXXPPPPXXAPPPXXXXXXXX----FXPPP--PPPP 776 PP V P P P PPPP +PPP PPP PPP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP 102 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 35.9 bits (79), Expect = 0.040 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP---PPPPP 776 PP V P P PPP +PPP PP PPP P Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP--PPP 776 P P PPP APPP PPP PPP Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPP 72 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP V P PPP APPP PP PPP Sbjct: 45 PPPVSAPPPVTTS--PPPVTTAPPPANPPPPVSSPPPASPPP 84 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPP PPP PPP PP Sbjct: 66 PPANPPPPVSSPPPASPPP-ATPPPVASPPPPVASPPPATPP 106 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PP P P PPP PPP P PPP L Sbjct: 72 PPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPL 116 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +3 Query: 651 PPXVXGXPXP--KPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P P PPP PPP P P P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 P P P PPP PPP PPP PPP Sbjct: 31 PAP-PTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPP 67 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXP----KPXXXPPPPXXAPPPXXXXXXXX----FXPPP--PPPP 776 PP V P P P PPPP +PPP PPP PPP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP 102 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 35.9 bits (79), Expect = 0.040 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G GGGGG GGG GGGG G G G GG Sbjct: 74 GYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGG 115 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGG GGG GGGG G G G Sbjct: 97 GGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGG 129 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGG GGG GGGG G G G Sbjct: 111 GGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGG GGG GGGG G G GG Sbjct: 90 GGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGG 129 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -1 Query: 775 GGG--GGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGG GGGG GGG GGGG G G G Sbjct: 99 GGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGG 135 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGG GGG GGGG G+G G GG Sbjct: 104 GGGGGHYGGGGGGHGGGGHYGGGGG---GYGGGGGHHGGG 140 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGG GGG GGGG G G G Sbjct: 83 GGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGG 116 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 G GG G GGG GGGG G G G GG+ Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGH 102 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -1 Query: 775 GGG--GGGGXXNXXXXXXXGGGAXXGGGGXXXGFG 677 GGG GGGG + GGG GGGG G G Sbjct: 106 GGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGG 140 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 GGGGG GGG GGGG G G GG+ Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGH 117 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -1 Query: 775 GGG--GGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 GGG GGGG GGG GGG G G G GG+ Sbjct: 92 GGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGH 136 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGG 695 GG GGGG GGG GGGG Sbjct: 115 GGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXG---FGXGXPXTXGG 650 GGGGG GGG GGGG G +G G GG Sbjct: 90 GGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGG 133 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGX-XXGFGXGXPXTXGG 650 GGG GG G G GGGG G+G G GG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGG 85 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG GGGG GG G GG +G G GG Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGG 92 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGA-XXGGGGXXXGFGXGXPXTXGGN 647 G GGGGG + G G GGGG G G G GG+ Sbjct: 52 GHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGH 95 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 35.9 bits (79), Expect = 0.040 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 696 PPPPXXAPPPXXXXXXXXFXPPPPPP 773 PPPP PPP PPPPPP Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPPPP 69 Score = 35.1 bits (77), Expect = 0.070 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 699 PPPXXAPPPXXXXXXXXFXPPPPPPP 776 PPP PPP PPPPPPP Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPPPP 69 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 678 PKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 P P PP PPP F PPPPPP L Sbjct: 36 PTRFFLPHPPPPPPPPPPPLYFSYFSLPPPPPPPHL 71 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGG GGG G G G+G G GG Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGG 141 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -3 Query: 773 GGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGG 669 GGGGGG GGG G G G G+ GG Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGG 135 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGGG GGG GGG G G G Sbjct: 113 GGGGGGGGDTGAGA---GGGGYGGGGDTGAGGGVG 144 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GG GGG GGGG G G G GG Sbjct: 96 GGGDVGGGGGGYGGGTPGGG---GGGGGDTGAGAGGGGYGGG 134 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 35.1 bits (77), Expect = 0.070 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXG--GGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGGG G GG GGG G+G G GG Sbjct: 210 GGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGG 253 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFG 677 GG GGGG GGG GGGG G G Sbjct: 195 GGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GG GG GGGA GGG G+G G Sbjct: 204 GGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSG 236 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -3 Query: 776 WGGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGG 669 +GGGGGG + GG GGG G G GG Sbjct: 251 YGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGG 286 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXG-GN 647 G GGGGG GGG GGGG +G G G GN Sbjct: 105 GEGGGGGYGGAAGGHAGGGGGGSGGGG-GSAYGAGGEHASGYGN 147 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GGG GG GGGG G G GG Sbjct: 190 GGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGG 231 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGG G + GG GG G G G G Sbjct: 40 GGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYG 74 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 G G G G GGGA GGGG G G G Sbjct: 144 GYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGG 178 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGG GGG G GG G G GG Sbjct: 173 GGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGG 214 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXG--GGGXXXGFGXGXPXTXGG 650 GGG GG GGG+ G GGG G G G GG Sbjct: 244 GGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 773 GGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGG 669 GGGGGG GGG GG G G GG Sbjct: 253 GGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 GGGG G GA GGG G+G G GG+ Sbjct: 129 GGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGH 171 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 G GGGG GGG GGG G G GG + Sbjct: 196 GAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGE 239 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXG-GGGXXXGFGXGXPXTXGG 650 GGG GG GGG G GGG G+G G GG Sbjct: 219 GGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGG 261 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -1 Query: 781 FXGGGGGGGXXNXXXXXXXGGGAXXG-GGGXXXGFGXGXP 665 + GGGGGG GGG+ G GGG G G P Sbjct: 251 YGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGGYAP 290 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GGG G GGG G G G + GG Sbjct: 58 GGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGG 99 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGGG GG GG G G GG Sbjct: 172 GGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGG 213 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGG-GXXXGFGXGXPXTXGG 650 GG GG GGGA GG G G+G G GG Sbjct: 177 GGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGG 219 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G G GGG GA GGGG G G GG Sbjct: 84 GSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGG 125 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGG + G G G GG G G GG Sbjct: 88 GGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGG 129 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 GGGG G + G G GGGG G G GG+ Sbjct: 175 GGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGS 217 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G G GGG GGA GGG G G G GG Sbjct: 186 GSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 G GGG G GGG GGGG G GG + Sbjct: 150 GEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGE 193 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -1 Query: 781 FXGGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 + GGGG GG GG+ GGG G G GG Sbjct: 165 YGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGG 208 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -1 Query: 775 GGGG--GGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGG GGG + GG GG G G G G + GG Sbjct: 224 GGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGG 267 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGG G GG GGG G G G GG Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGG 75 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G GGG GGG GG G+G G GG Sbjct: 159 GYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGG 199 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGG + GGG GGGG G G GG Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG 137 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGG GGG GGGG G G G + GG Sbjct: 133 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 173 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -1 Query: 775 GGG--GGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 GGG GGGG GGG GGGG G G GG + Sbjct: 108 GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRR 153 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGG GGG GGGG G G G GG Sbjct: 106 GGGGGYSGGGGSYGGGGGRREGGGGYSGG-GGGYSSRGGG 144 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGG GGG GGG G G G GG Sbjct: 90 GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG 130 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGG GGG GG +G G GG Sbjct: 119 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGG 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -3 Query: 776 WGGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGG 669 + GGGGG GGG GG G G GG Sbjct: 131 YSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG 166 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 781 FXGGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 F GG GG G GGG G GG G G G P GG Sbjct: 320 FPGGMGGMGGMPGGFPGGMGGGMPAGMGGGMPGMGGGMPAGMGG 363 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 8/46 (17%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP--------PPPPXXL 785 P P+ PPPP PPP + PPP PPPP L Sbjct: 64 PPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPL 109 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 8/50 (16%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP-----PXXAPPPXXXXXXXXFXPPP---PPPP 776 PP P P P PPP P PPP PPP PPPP Sbjct: 64 PPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPP 113 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP---PPPPPXXL 785 PP P P P P P PPP PP PPPPP L Sbjct: 72 PPPPQSLPPPSPS--PEPEHYPPPPYHHYITPSPPPPRPLPPPPPPPL 117 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGG GGG GGGG G G G + GG Sbjct: 116 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 156 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -1 Query: 775 GGGG--GGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 GGGG GGG GGG GGGG G G GG + Sbjct: 91 GGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRR 136 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G GGGG GGG GGGG G G G GG Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGGYSGG-GGGYSSRGGG 127 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGG GGG GG +G G GG Sbjct: 102 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGG 141 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -3 Query: 776 WGGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGG 669 + GGGGG GGG GG G G GG Sbjct: 114 YSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG 149 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 GGGGGGG GGG G GG G G GG K Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGK 114 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGGG GGG GGGG G+G G GG Sbjct: 70 GGGGGGG--------GGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 776 WGGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGG 669 WG GGGG GGG GGG G G GG Sbjct: 67 WGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 766 GGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG G GGG GGGG G G G GG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGG 98 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = -3 Query: 773 GGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGGPPHXRGEQ 645 GGGGGG G G GGG G + GG +G + Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGRE 119 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG G GGG GGGG G G G GG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGG 99 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 FPP P P P PP P PPP PPP PP Sbjct: 164 FPPFSPSIPPPSPPYFPPEPPSIPPP----------PPPSPP 195 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PP P PP PPPPP P Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPP-----EPPSIPPPPPPSP 194 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP V P P PP APPP PPPPP P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGP----KPPPPPGP 408 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 670 PPXQNPXXPXPP--PXXPPPLXGXXXFXXFXPPPPPPXK 780 PP ++ P PP P PPP F PPPPP K Sbjct: 153 PPKRSRGPPRPPTRPKSPPPRKSS--FPPSRSPPPPPAK 189 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP V P P PP APPP PPPPP P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGP----KPPPPPGP 408 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 670 PPXQNPXXPXPP--PXXPPPLXGXXXFXXFXPPPPPPXK 780 PP ++ P PP P PPP F PPPPP K Sbjct: 153 PPKRSRGPPRPPTRPKSPPPRKSS--FPPSRSPPPPPAK 189 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGG GG GG + GGGG G G G GG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGG 131 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGG G GGG GGGG G G G Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGG GG GGGG G+G G GG Sbjct: 112 GGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGG 153 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGG + GGG GGGG G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 781 FXGGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 + GGGGGG GGG G GG G G G Sbjct: 132 YGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G GGGGG GGG GGGG G G G GG Sbjct: 86 GSGGGGGGRG-----GSGGGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -3 Query: 773 GGGGGGXKXXXXXXPXR--GGGXXGGGXGXXGFWXGG 669 GGGGGG R GG GGG G G+ GG Sbjct: 111 GGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGG 147 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 GGGG G GGG GG G G G GG + Sbjct: 105 GGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGR 148 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 685 PXXPXPPPXXPPPLXGXXXFXXFXPPPP 768 P P PPP PPP + F PPPP Sbjct: 105 PPPPPPPPPPPPPSSTWDFWDPFIPPPP 132 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP--PXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPP P PPPPPPP Sbjct: 68 PPSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPP 111 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 684 PXXXPPPPXXAPPPXXXXXXXXFXPPPP 767 P PPPP PP F PPPP Sbjct: 105 PPPPPPPPPPPPPSSTWDFWDPFIPPPP 132 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 8/43 (18%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPPLXGXXXFXXF--------XPPPPPP 774 PP +P P PP PPPL + PPPPPP Sbjct: 68 PPSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPP 110 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 696 PPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PPPP PPP + P PPPP Sbjct: 106 PPPPPPPPPPPPSSTWDFWDPFIPPPP 132 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 696 PPPPXXAPPPXXXXXXXXFXPP--PPPP 773 PPPP PPP F P PPPP Sbjct: 105 PPPPPPPPPPPPPSSTWDFWDPFIPPPP 132 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 660 VXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 V P P P PPPP +PPP PP PPPP Sbjct: 60 VVDEPPPPPPTSPPPP--SPPPPSPPPPSP-PPPSPPPP 95 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPP 725 PP P P P PPP PPP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPP 90 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 G GGGGG GGG GGGG G G G Sbjct: 74 GYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGG 108 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGG GGG GGGG G G G Sbjct: 83 GGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHG 116 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G GG G GGG GGGG G G G GG Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGG 101 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGX-XXGFGXGXPXTXGG 650 GGG GG G G GGGG G+G G GG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGG 85 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG GGGG GG G GG +G G GG Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGG 92 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGA-XXGGGGXXXGFGXGXPXTXGGN 647 G GGGGG + G G GGGG G G G GG+ Sbjct: 52 GHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGH 95 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -1 Query: 775 GGGGGG--GXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGG G G GGG GGGG G G G Sbjct: 66 GGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGG 102 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG GG + GGG GGGG G G GG Sbjct: 62 GGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGG 102 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 773 GGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGGPPHXRG 651 GGGGGG K P GG GG G GGPPH G Sbjct: 45 GGGGGGSKP-----PPHHGGKGGGKPPPHGGKGGGPPHHGG 80 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGGG GGG GG G G P GG Sbjct: 44 GGGGGGGSKPPPHHGGKGGGKPPPHGGK----GGGPPHHGGG 81 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P PPPP PPP PPP P Sbjct: 870 PEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSP 903 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP--XXAPPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPP +PPP PP PPPPP Sbjct: 46 PPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPP 94 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX--PPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P P PPPP P PPPPP Sbjct: 143 PPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPP 184 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 73 PPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 124 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 93 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 144 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 113 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPP 164 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 9/51 (17%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 123 PPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPP 173 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 293 PPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPP 344 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 153 PPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPP 204 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 173 PPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 224 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 193 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 244 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 213 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 264 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 233 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 284 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 253 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPP 304 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 273 PPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPP 324 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P P PPPP P + PPP P Sbjct: 313 PPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAP 355 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXP-PPPXXAPPPXXXXXXXXFXPPPPPP 773 PP V P P P PPP PP + PPPPP Sbjct: 38 PPYVYNSPPPYVYNSPSPPPYVYKPP-----PYIYSSPPPPP 74 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGG G GGG GGGG G G G Sbjct: 385 GGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGG 419 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGGG GGG GGG G G G Sbjct: 400 GGGGGGGDGGGGQGTGIGGG---GGGEQGTGVGGG 431 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 G GGGG GGG G GG G G G Sbjct: 383 GWGGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIG 417 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = -3 Query: 776 WGGGGGGX-KXXXXXXPXRGGGXXGGGXGXXGFWXGG 669 WGGGG G GGG GGG G GG Sbjct: 384 WGGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGG 420 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 G GGGG GGG+ GGGG G+G G Sbjct: 379 GVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGG 413 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXP 665 GGGGG N GGG GG G G G P Sbjct: 300 GGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEP 334 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GGG GGG G G G+G GG Sbjct: 237 GGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGG 278 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGG--GGXXXGFGXGXPXTXGGN 647 GG GGG GGG GG GG G+G G GG+ Sbjct: 355 GGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGS 399 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGG G GGG GGGG G G G Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGG + GGG GGGG G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGG GG GG + GGGG G G G Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G GGGGG GGG GGGG G G G GG Sbjct: 86 GSGGGGGGRG-----GSGGGYRSGGGGGYSGGGGGGYSGGGG 122 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXG 653 GG GGGG GGG GGGG G G G + G Sbjct: 149 GGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGGSCYSCG 189 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGG GGG GGG GGG G G G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 G GGG G G G GG G G G GG + Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGR 126 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 GGG GG G G+ G GG G+G GG+ Sbjct: 87 GGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGS 129 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P+P PPPP PPP PPP PP Sbjct: 266 PPPPAAAPPPQPPP-PPPPKPQPPPPPKIA----RPPPAPP 301 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 678 PKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P PPPP A PP P PPPPP Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 GGGGGGG GGG G GG G G GG K Sbjct: 65 GGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASG--GAGGGGK 106 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GG GG GGGG G G G GG Sbjct: 283 GGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGG 323 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GG GG GGGG G G G GG Sbjct: 351 GGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGG 391 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GG GG GGGG G G G GG Sbjct: 433 GGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGG 473 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGGG GG GG G G G GG Sbjct: 64 GGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGG 105 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXG-GGGXXXGFGXGXPXTXGG 650 GG G G GGGA G GGG G G G + GG Sbjct: 525 GGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGG 566 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXG 653 GGG GG GGG G GG G G T G Sbjct: 182 GGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVG 221 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXG-GGGXXXGFGXGXPXTXGG 650 G G GG GGGA G GGG G G G GG Sbjct: 476 GSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGG 518 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG G GG GGGA G GG G G GG Sbjct: 77 GGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGG 118 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGG GG G G G GG G G G GG Sbjct: 112 GGGGAGGGVGGGVGAGGGAGGSVGAGG---GIGGGAGGAIGG 150 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 G GG G GG GGGG G G G GGN Sbjct: 226 GSGGASGGVGVGGGAGGSGGGSVGGGGRGSG-GVGASGGAGGN 267 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXG-GGGXXXGFGXGXPXTXGG 650 GG GG GGG G GGG G G G GG Sbjct: 322 GGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGG 364 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXG--GGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GGG G GGA GGGG G G GG Sbjct: 429 GGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGG 472 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGG GG G G G G G GG Sbjct: 453 GGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGG 494 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGG-GXXXGFGXGXPXTXGG 650 GG G GG GGG GGG G G G G GG Sbjct: 159 GGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGG 201 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GGG GG+ GGG G G G GG Sbjct: 168 GGGAGGGVGGGVGAGGGAGGSVGAGGG--IGSGGGGTVGAGG 207 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG G GGG GGGG G G GG Sbjct: 176 GGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGG 216 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG G G G G GGGG G G GG Sbjct: 192 GGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGG 233 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -1 Query: 775 GGG--GGGGXXNXXXXXXXGGGAXXG-GGGXXXGFGXGXPXTXGGN 647 GGG GGGG + G G G GGG G G G GG+ Sbjct: 244 GGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGS 289 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -1 Query: 775 GGGG--GGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGG GGG GG+ GGG G G G GG Sbjct: 455 GGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGG 498 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G GG G GG GGGG G G G GG Sbjct: 466 GSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGG 506 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G G GGG GGG GG G G G GG Sbjct: 50 GAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGG 91 Score = 29.1 bits (62), Expect = 4.6 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXG-GGGXXXGFGXGXPXTXGG 650 GG GGGG GGGA G GGG G G G GG Sbjct: 154 GGVGGGGKGR---GGKSGGGAGGGVGGGVGAGGGAGGSVGAGG 193 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGG G GGG G GG G G GG Sbjct: 198 GGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGG 239 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 G GG G GGGA GGG G G G Sbjct: 221 GAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRG 254 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG GG GG+ GGG G G G GG Sbjct: 402 GGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGG 442 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGG GG GGG GG G G G G Sbjct: 471 GGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVG 505 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG GGG G G GG G G G G GG Sbjct: 449 GGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGG 490 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GG GGG GGG G G G GG Sbjct: 471 GGGTGGSVGAGGGVGVGGGGGIGGGAGG-GVGGGVGGGVGG 510 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXG--GGAXXGGGGXXXGFGXG 671 GGG GGG G GGA G GG G G G Sbjct: 505 GGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAG 541 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXG 653 GG GG GGG GG G G G G + G Sbjct: 95 GGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVG 135 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXG-GGGXXXGFGXGXPXTXGG 650 GG GGG GGGA G GGG G G G GG Sbjct: 99 GGAGGG--GKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGG 138 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G GG GG GG GG G G G G GG Sbjct: 239 GAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGG 280 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGG--GAXXG-GGGXXXGFGXGXPXTXGG 650 GGGG G GG GA G GGG G G G + GG Sbjct: 249 GGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGG 292 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -1 Query: 775 GGG--GGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GGGG + GGA GG G G G G GG Sbjct: 306 GGGSVGGGGRGSGGASGGASGGAS-GGAGGSVGAGGGVGGGVGG 348 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGG--GAXXGG-GGXXXGFGXGXPXTXGG 650 GGG GGG GG GA G GG G G G GG Sbjct: 493 GGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGG 537 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXP-PPPXXAPPPXXXXXXXXFXPP------PPPPP 776 PP P P P P PPP +PPP PP PPPPP Sbjct: 101 PPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPP 149 Score = 32.7 bits (71), Expect = 0.37 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXX----APPPXXXXXXXXFXPPPPPPP 776 P P P P PPPP APPP PPPPP P Sbjct: 110 PPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPI---PPPPPAP 151 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 776 WGGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGGPPHXRGE 648 WGG GGG GGG GGG G G W GG GE Sbjct: 34 WGGAGGGE-----WGGAEGGGAWGGGGGGGGAW-GGEGEGGGE 70 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 GG GGG GGG GGGG G G G GG + Sbjct: 35 GGAGGGEWGGAEGGGAWGGGG--GGGGAWGGEGEGGGEWGGGGE 76 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -3 Query: 776 WGGGGGGXKXXXXXXPXRG---GGXXGGGXGXXGFW 678 WGGGGGG G GG GGG G G++ Sbjct: 51 WGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRGWF 86 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGF 680 GGGGGG GG GGGG G+ Sbjct: 54 GGGGGGAWGGEGEGGGEWGGGGEGGGGGRRGW 85 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -1 Query: 781 FXGGGG-GGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 + GGGG GGG GGG+ G GG G G G GG Sbjct: 23 YGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGG 67 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -1 Query: 781 FXGGGG-GGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 + GGGG GGG GGG+ G GG G G G GG Sbjct: 23 YGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGG 67 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 699 PPPXXAPPPXXXXXXXXFXPPPPPPP 776 PPP PPP F PPPPPPP Sbjct: 98 PPPQPPPPP---QPLNLFSPPPPPPP 120 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 700 PPPXXPPPLXGXXXFXXFXPPPPPP 774 PPP PPP F PPPPPP Sbjct: 98 PPPQPPPP---PQPLNLFSPPPPPP 119 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGG 695 GGGGGG N GGG GGGG Sbjct: 103 GGGGGGNNNNNKKGQKNGGGGGGGGGG 129 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 764 GGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGGP 666 GG K P GGG GGG G G GGP Sbjct: 250 GGPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGP 282 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGG 695 GGGGG N GGG GGGG Sbjct: 104 GGGGGNNNNNKKGQKNGGGGGGGGGGG 130 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGG-GGXXXGFGXGXP 665 GGGGG N GGG GG G G G P Sbjct: 304 GGGGGGPNAGKKGNGGGGPMAGGVSGGFRPMGGGGP 339 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 5/40 (12%) Frame = +3 Query: 672 PXPKPXXXPPPPXXA-----PPPXXXXXXXXFXPPPPPPP 776 P P P PPPP PPP P PPPPP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 681 KPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 KP PPPP PPP PPPPPPP Sbjct: 238 KPDPTPPPPP--PPPIPVKQSAT--PPPPPPP 265 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPPXK 780 PP PPP PP L PPPPPP K Sbjct: 249 PPIPVKQSATPPPPPPPKLKNNGP----SPPPPPPLK 281 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 672 PXPKPXXXPPP-PXXAPPPXXXXXXXXFXPPPPPP 773 P P+P PPP P APPP P PP P Sbjct: 73 PKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAP 107 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P P PP P P PP P P Sbjct: 55 PPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKP 95 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +3 Query: 672 PXPKPXXXPPP-PXXAPPPXXXXXXXXFXPPPPPP 773 P P P PPP P PPP PP P P Sbjct: 26 PGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQP 60 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P PKP P PP PP PP P P Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKP 87 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXP-PPPXXAP-PPXXXXXXXXFXPPPPPPP 776 PP PKP P PPP P PP PP PP P Sbjct: 64 PPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAP 107 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P P P PP PPP P P Sbjct: 82 PPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAP 123 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXP-PPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P P PPP +P P P PPP Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPP 66 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P P P PPP P P PPP Sbjct: 43 PPAPSPSPCPSPP-PKPQPKPVPPPACPPTPPKPQPKPAPPP 83 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXP-PPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P P PPP P P P P PP Sbjct: 72 PPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPP 114 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +3 Query: 672 PXPKPXXXP-PPPXXAPPPXXXXXXXXFXPPPPPPP 776 P PKP P P P +PPP PP PP Sbjct: 38 PQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPP 73 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXP---PPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P P PPP P P P P P P Sbjct: 35 PPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKP 79 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P+P PPP PP P P PP Sbjct: 56 PKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPP 90 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 33.1 bits (72), Expect = 0.28 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -1 Query: 781 FXGGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 F GGG GGG GGGA GG G G+G G GGN Sbjct: 125 FGGGGYGGGGGGYGGSGGYGGGA--GGYGGSGGYG-GGAGGYGGN 166 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = -1 Query: 781 FXGGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 + GGGGG G G G G GG G+G GGN Sbjct: 130 YGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGN 174 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 GG GGG GGGA GG G+G GG+ Sbjct: 141 GGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGS 182 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX------PPPPXXAPPPXXXXXXXXFXPPPPP 770 PP P P P PP P +PPP + PPPPP Sbjct: 717 PPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPP 762 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P+P PPPP + PP PPPP P Sbjct: 704 PPAPYYYSSPQP---PPPPHYSLPPPTPTYHYISPPPPPTP 741 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PP +PPP + PPPPP P Sbjct: 736 PPPPTPIHSPPPQSHPPCIEYSPPP---PPTVHYNPPPPPSP 774 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P PPP PPP PPPPP P Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPP--TPTYHYISPPPPPTP 741 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 11/53 (20%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPX---XAPPPXXXXXXXXFXPPPP-----PPP 776 PP + P P P PPPP +PPP PPPP PPP Sbjct: 751 PPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPP 803 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPP 771 PP + P PPP PL PPPPP Sbjct: 804 PPVIHHSQPPPPPIYEGPLPPIPGISYASPPPPP 837 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 SP G P +P P PP PP+ G PPP P Sbjct: 583 SPPFTGPSPPSSPSPPLPPVIPSPPIVGP---TPSSPPPSTP 621 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGG GGG GGGG G G G Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDG 154 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 770 GGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGG 669 GGGGG GGG GGG G G GG Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGG 155 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 776 WGGGGGGXKXXXXXXPXRGGGXXGGGXGXXGF 681 + GGGGG GGG GGG G GF Sbjct: 127 YSGGGGGYGGGGGGYGGGGGGYGGGGDGGGGF 158 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -1 Query: 775 GGG--GGGGXXNXXXXXXXGGGAXXGGGGXXXG 683 GGG GGGG GGG GGGG G Sbjct: 124 GGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGF 680 GGGGG GGG GGG GF Sbjct: 129 GGGGGYGGGGGGYGGGGGGYGGGGDGGGGF 158 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GGG GGG+ GGG G G + GG Sbjct: 76 GGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGG 117 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG GGGG GG + GGGG G G GG Sbjct: 77 GGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGG 118 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGG GGG GGGG G G GG Sbjct: 73 GGGGGGRGGGGFG---GGGRSFGGGGSSSRGGGGSSSRGGG 110 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 GGGGGGG G G GGG G G GG K Sbjct: 83 GGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGK 126 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G G GGG GG GGGG G G G GG Sbjct: 6 GSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGG 47 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG G GG GGG GGGG G G + GG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGG 46 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 GGGG GG GG GG G G G G N+ Sbjct: 17 GGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNR 60 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGG G GGGG G G G Sbjct: 15 GGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGG 49 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG GGGG GGG GG G G G G GG Sbjct: 75 GGSGGGGKGGGG-----GGGISGGGAGGKSGCGGGKSGGGGG 111 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -1 Query: 775 GGGGGG--GXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 GGGGGG G GG + GGGG G G G G K Sbjct: 84 GGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGK 129 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GG GGG GG G G G GG Sbjct: 92 GGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGG 132 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 GGGGGGG GG GGG G P + G + Sbjct: 107 GGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGGYMVAPGSNGSS 149 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGG G G G G GG G G G GG Sbjct: 78 GGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGG 118 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 GGG GG GGG GGG G G + GG+ Sbjct: 92 GGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGS 134 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGG GGG GG + GGG G G G Sbjct: 79 GGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGG 113 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 724 GGGAXXGGGGXXXGFGXGXPXTXGGNK 644 GGG GGGG G G G GG K Sbjct: 79 GGGKGGGGGGGISGGGAGGKSGCGGGK 105 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGG GG GG GGG G G G Sbjct: 78 GGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGG 112 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P PKP PP P AP P P PP P Sbjct: 46 PAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKP 86 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P PKP P PP P P P P PP Sbjct: 33 PAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPP 73 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P PKP P PP P P P P PP Sbjct: 44 PTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P PKP P PP P P P P PP Sbjct: 55 PKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPP 95 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P PKP P PP P P P P PP Sbjct: 66 PAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPP 106 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P PKP P PP P P P P PP Sbjct: 29 PKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPP 62 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P PKP P PP P P P P P P Sbjct: 77 PAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTP 118 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P PKP PP P P P P P P P Sbjct: 79 PAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAP 120 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P P PP P AP P P PP P Sbjct: 57 PAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNP 97 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P PP P P P P PP P Sbjct: 31 PKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKP 64 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P P PP P P P P PP P Sbjct: 35 PAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKP 75 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P P PP P P P P PP P Sbjct: 68 PAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKP 108 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P+ PPPP P PPPPP Sbjct: 183 PPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPP 223 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 6/48 (12%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP------PPPPP 776 PP G P P PP PPP PP PPPPP Sbjct: 176 PPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPP 223 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 + PP G P PPPP PP F PPPP Sbjct: 165 MLPPPPFGGQGPPMGRGPPPPYGMRPP-----PQQFSGPPPP 201 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P+ PPPP P PPPPP Sbjct: 183 PPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPP 223 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 6/48 (12%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP------PPPPP 776 PP G P P PP PPP PP PPPPP Sbjct: 176 PPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPP 223 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 + PP G P PPPP PP F PPPP Sbjct: 165 MLPPPPFGGQGPPMGRGPPPPYGMRPP-----PQQFSGPPPP 201 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXA----PPPXXXXXXXXFXPPPPPP 773 FPP P PKP PPP PPP PPPP Sbjct: 315 FPPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPP 360 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA----PPPXXXXXXXXFXPPPPPP 773 PP P PKP PPP PPP PPPP Sbjct: 366 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPP 410 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP----XXAPPPXXXXXXXXFXPPPPPP 773 PP P PKP PPP PPP PPPP Sbjct: 191 PPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPP 235 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA----PPPXXXXXXXXFXPPPPPP 773 PP P PKP PPP PPP PPPP Sbjct: 266 PPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPP 310 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA----PPPXXXXXXXXFXPPPPPP 773 PP P PKP PPP PPP PPPP Sbjct: 593 PPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPP 637 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA----PPPXXXXXXXXFXPPPPPP 773 PP P PKP PPP PPP PPPP Sbjct: 643 PPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP 687 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA----PPPXXXXXXXXFXPPPPPP 773 PP P PKP PPP PPP PPPP Sbjct: 693 PPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP 737 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/44 (31%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPP----XXXXXXXXFXPPPPPP 773 P P P PPPP +P P + PPPPP Sbjct: 704 PTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPP 747 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP-PXXAPPPXXXXXXXXFXPPPPPPP 776 PP V P P P PPP +PPP PPP PP Sbjct: 35 PPPVT--PPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPP 75 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP----PPPPP 776 PP + P PPP A PP PP PPPPP Sbjct: 74 PPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPP 119 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP-----PPP 776 PP V P P P PP PP PPPP PPP Sbjct: 57 PPPVVSSPPPSSSPPPSPPVITSPPPTVAS----SPPPPVVIASPPP 99 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PPP +P P P PP P Sbjct: 117 PPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKP 158 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP--XXAPPPXXXXXXXXFXPPPP----PPP 776 PP + P P PPPP +PPP F PPPP PPP Sbjct: 128 PPVLLSPPPPPVNLSPPPPPVLLSPPP----PPVLFSPPPPTVTRPPP 171 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP--XXAPPPXXXXXXXXFXP---PPPPPPXXL 785 PP + P P PPPP +PPP P PPPPP L Sbjct: 92 PPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNL 141 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP--XXAPPPXXXXXXXXFXPPPPP 770 PP + P P PPPP +PPP PPPPP Sbjct: 119 PPVLLSPPPPPVLLSPPPPPVNLSPPP----PPVLLSPPPPP 156 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX--PPPPXX--------APPPXXXXXXXXFXPPPPPPP 776 PP P P P PPPP PPP + PPPPPPP Sbjct: 162 PPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVY-PPPPPPP 212 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 6/50 (12%) Frame = +3 Query: 654 PXVXGXPXPKPXXX--PPPPXXAPPPXXXXXXXXFXPP----PPPPPXXL 785 P V P P P PPPP PP PP PPPPP L Sbjct: 38 PLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNL 87 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +3 Query: 651 PPXVXGXPXPKPX-XXPPPP--XXAPPPXXXXXXXXFXP---PPPPPPXXL 785 PP V P P P PPPP +PPP P PPPPP L Sbjct: 64 PPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNL 114 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +3 Query: 651 PPXVXGXPXPKPX-XXPPPP--XXAPPPXXXXXXXXFXP---PPPPPPXXL 785 PP V P P P PPPP +PPP P PPPPP L Sbjct: 73 PPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLL 123 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 651 PPXVXGXPXPKPX-XXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP V P P P PPPP PP PPPP P Sbjct: 145 PPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITR--SPPPPRP 184 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP--XXAPPPXXXXXXXXFXP---PPPPPPXXL 785 PP P P PPPP +PPP P PPPPP L Sbjct: 47 PPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLL 96 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPX-XXPPPPXXAPPPXXXXXXXXFXPPP----PPPPXXL 785 PP V P P P PPPP P PPP PPPP L Sbjct: 109 PPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVL 158 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPPXK 780 PP PPP PPP + PPPPPP K Sbjct: 196 PPPYKYGRVYPPP--PPPPQAARSYKR-SPPPPPPSK 229 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA-------PPPXXXXXXXXFXPPPP 767 PP G P P PPPP A PPP + PPPP Sbjct: 197 PPYKYGRVYPPP---PPPPQAARSYKRSPPPPPPSKYGRVYSPPPP 239 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPP PPP PPP P Sbjct: 201 PPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIP 242 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P PK PP P PPP P PP P Sbjct: 209 PPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKP 250 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP + P P P PPP PPP PPP P Sbjct: 250 PPKIE-HPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVP 290 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPP PPP P PP PP Sbjct: 216 PPPKKEVPPPVPVYKPPPKVELPPPIPK------KPCPPKPP 251 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P P PPP PPP PPP P Sbjct: 193 PPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVP 227 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPP--XXXXXXXXFXPPPP---PPP 776 PP P PK PP P PPP + PPP PPP Sbjct: 194 PPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPP 240 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P PK PP P PPP PPP P Sbjct: 314 PPTKKPCP-PKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVP 353 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 + PP P P P PPP PP PPP P Sbjct: 340 VIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVP 381 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXP---PPPPPP 776 PP P PK PP P PPP P P PPP Sbjct: 335 PPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPP 379 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 672 PXPKPXXXP--PPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P P PPP PP PPPPPP Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 652 PRXXGGPPXQNPXXPXPPPXXPPP 723 P G PP P P PPP PPP Sbjct: 21 PPPVGVPPQYYPPPPPPPPPPPPP 44 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G GGGGG GGG GGGG G G G GG Sbjct: 118 GSGGGGGHGGGGG----GGGGRGGGGGSGNGEGYGEGGGYGG 155 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGGG G GGG G+G G Sbjct: 126 GGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 773 GGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGGPPHXRGE 648 G G GG GGG GGG G G GG GE Sbjct: 104 GSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGE 145 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 G G GGG + GG GG G G+G G Sbjct: 116 GRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEG 150 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP--PP 776 P P P PPP PPP PPP P PP Sbjct: 56 PPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPP 92 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 678 PKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P PPP PPP PPPPP Sbjct: 84 PPPTPIYPPPVAFPPPQAYQAYYYRKSPPPPP 115 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P PP P +PP + PP PP Sbjct: 57 PPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPP 98 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +1 Query: 646 CSPRXXGGPPXQNPXXPXPPP---XXPPPLXGXXXFXXFXPPPP 768 C+P PP P PPP PPPL + PPPP Sbjct: 84 CTPCLQNIPPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 P QN P PPP PPP PPP PP Sbjct: 86 PCLQNIPPPSPPPPSPPP-----PSQACPPPPLPP 115 >At4g39680.1 68417.m05614 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 633 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 678 PKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P PPPP A PP P PPPPP Sbjct: 559 PPPTALPPPPPLAKPPHVVER----LPLPPPPP 587 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 670 PPXQN--PXXPXPPPXXPPPLXGXXXFXXFXPPPPPPXK 780 PP + P P PP PPP P PPPP K Sbjct: 142 PPSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSPPPPSK 180 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PP +P PPPP PP P PPPP L Sbjct: 141 PPPSKTHEPSRPNTPPPPP---PPSKTHEPSRRITPSPPPPSKIL 182 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 684 PXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 P PPPP A PP F PPPPP Sbjct: 230 PPPPPPPPHQAQPP-PPPPSGLFPPPPPP 257 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP 767 PP P PPP PPP F P PP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPP 268 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 685 PXXPXPPPXX--PPPLXGXXXFXXFXPPPPPP 774 P P PPP PPP F PPPPPP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLF----PPPPPP 257 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P V P KP P PPP + PP PPP Sbjct: 298 YSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPP 340 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/46 (30%), Positives = 17/46 (36%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 + P + P KP P PPP + PP PPP L Sbjct: 634 YSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQL 679 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 ++ P + P KP P PPP + PP PPP Sbjct: 212 IYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPP 255 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 ++ P V P KP P PPP + PP PPP Sbjct: 347 IYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPP 390 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P V P KP P PPP + PP PPP Sbjct: 482 YSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPP 524 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P + P KP P PPP + PP PPP Sbjct: 651 YSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPP 693 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P + P KP P PPP + PP PPP Sbjct: 112 YSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPP 154 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P + P KP P PPP + PP PPP Sbjct: 129 YSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPP 171 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 ++ P + P KP P PPP + PP PPP Sbjct: 195 IYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPP 238 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 ++ P + P KP P PPP + PP PPP Sbjct: 246 IYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPP 289 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 ++ P V P KP P PPP + PP PPP Sbjct: 364 IYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPP 407 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 ++ P V P KP P PPP + PP PPP Sbjct: 431 IYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPP 474 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P V P KP P PPP + PP PPP Sbjct: 230 YSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPP 272 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 670 PPXQNPXXPX-PPPXXPPPLXGXXXFXXFXPPPPPPXK 780 PP Q P P PP PPP+ P PPP K Sbjct: 489 PPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVK 526 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P + P KP P PPP + PP PPP Sbjct: 532 YSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPP 574 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P + P KP P PPP + PP PPP Sbjct: 549 YSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 591 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P + P KP P PPP + PP PPP Sbjct: 566 YSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 608 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P + P KP P PPP + PP PPP Sbjct: 583 YSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 625 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P + P KP P PPP + PP PPP Sbjct: 600 YSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 642 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P + P KP P PPP + PP PPP Sbjct: 617 YSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 659 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 670 PPXQNPXXPX-PPPXXPPPLXGXXXFXXFXPPPPPPXK 780 PP Q P P PP PPP+ P PPP K Sbjct: 305 PPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVK 342 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/54 (29%), Positives = 20/54 (37%), Gaps = 10/54 (18%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPP----------PXXAPPPXXXXXXXXFXPPPPPPP 776 ++PP + P P PPP P PPP + PP PPP Sbjct: 67 IYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPP 120 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P + P KP P PPP + PP PPP Sbjct: 95 YSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPP 137 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP-----PXXAPPPXXXXXXXXFXPPPPPPP 776 PP P KP PP P PPP + PP PPP Sbjct: 327 PPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPP 373 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP-----PXXAPPPXXXXXXXXFXPPPPPPP 776 PP P KP PP P PPP + PP PPP Sbjct: 461 PPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPP 507 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP-----PXXAPPPXXXXXXXXFXPPPPPPP 776 PP P KP PP P PPP + PP PPP Sbjct: 175 PPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPP 221 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP-----PXXAPPPXXXXXXXXFXPPPPPPP 776 PP P KP PP P PPP + PP PPP Sbjct: 511 PPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 557 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P V P P P PPP + PP PPP Sbjct: 668 YSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPP 710 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/44 (29%), Positives = 16/44 (36%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 ++ P V P KP P PP + PP PPP Sbjct: 280 IYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPP 323 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + P V P P P PPP + PP PPP Sbjct: 685 YSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPP 727 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP----PPPP 776 PP P P PPP +PPP + PPP PPPP Sbjct: 40 PPVYKSPPPPVKHYSPPPVYKSPPP----PVKHYSPPPVYKSPPPP 81 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP----PPPP 776 PP P P PPP +PPP + PPP PPPP Sbjct: 112 PPVYKSPPPPVKHYSPPPVYKSPPP----PVKHYSPPPVYKSPPPP 153 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 8/50 (16%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPP----XXXXXXXXFXPPP----PPPP 776 PP P P PPP +PPP + PPP PPPP Sbjct: 72 PPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPP 121 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP----PPPP 776 PP P P PPP +PPP + PPP PPPP Sbjct: 40 PPVYKSPPPPVKHYSPPPVYKSPPP----PVKHYSPPPVYKSPPPP 81 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP----PPPP 776 PP P P PPP +PPP + PPP PPPP Sbjct: 112 PPVYKSPPPPVKHYSPPPVYKSPPP----PVKHYSPPPVYKSPPPP 153 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 8/50 (16%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPP----XXXXXXXXFXPPP----PPPP 776 PP P P PPP +PPP + PPP PPPP Sbjct: 72 PPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPP 121 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PP P PP PPP P Sbjct: 118 PPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAP 159 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPPP 776 PP P P P PPP +PPP P P PP P Sbjct: 125 PPPTPASPPPAP-ASPPPAPASPPPAPVSPPPVQAPSPISLPPAP 168 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPPXK 780 SP P P P P P PPP+ P P P K Sbjct: 131 SPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAPTK 174 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP--PP 776 PP P P PP P PP PPP P PP Sbjct: 104 PPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPP 147 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 678 PKPXXXPPPPXXAP-PPXXXXXXXXFXPPPPPPP 776 P P PPP +P PP PPPPPP Sbjct: 152 PPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P P PP PPP PPPPPP Sbjct: 152 PPPESLPPPSPESPSPPSPEPPPP------SSLEPPPPPP 185 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 31.9 bits (69), Expect = 0.65 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 353 PPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 404 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 53 PPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPP 104 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 73 PPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPP 124 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 93 PPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPP 144 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 333 PPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPP 384 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 373 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 424 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 393 PPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP 444 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 123 PPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 174 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 143 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 194 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 163 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 214 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 183 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 234 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 203 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 254 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 223 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 274 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 243 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 294 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 263 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 314 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 283 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 334 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX---PPPPXX--APPPXXXXXXXXFXPP-----PPPPP 776 PP V P P P PPPP +PPP PP PPPPP Sbjct: 303 PPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPP 354 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +3 Query: 651 PPXVXGXPXPKPXXX----PPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P P PPP PP + PPPP Sbjct: 433 PPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPPPP 476 >At4g00180.1 68417.m00019 axial regulator YABBY3 (YABBY3) identical to YABBY3 [Arabidopsis thaliana] GI:4928753 Length = 240 Score = 25.8 bits (54), Expect(2) = 0.70 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +3 Query: 750 FXPPPPPPP 776 F PPPPPPP Sbjct: 82 FLPPPPPPP 90 Score = 24.6 bits (51), Expect(2) = 0.70 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 756 PPPPPPPXXL 785 PPPPPPP L Sbjct: 85 PPPPPPPPNL 94 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXP 665 GGGGG GGG GGGG GF P Sbjct: 19 GGGGGRFGGGGGRFGGGGGRFGGGGGRFGGFRDEGP 54 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 763 GGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG GGG GGGG G G G GG Sbjct: 7 GGGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGGG 44 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -1 Query: 775 GGG--GGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGG G GG GGG GGGG G G G Sbjct: 8 GGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGGG 44 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 773 GGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGGPP 663 GGGGG GG GGG GF GPP Sbjct: 19 GGGGGRFGGGGGRFGGGGGRFGGGGGRFGGFRDEGPP 55 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 766 GGGGXXNXXXXXXXGGGAXXGGGGXXXGFG 677 GGGG GGG GGGG G G Sbjct: 7 GGGGFRGRGGRDGGGGGRFGGGGGRFGGGG 36 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GG GGG + GGG GGGG G G G Sbjct: 82 GGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G GG GG + GG GGG G+G G GG Sbjct: 46 GHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGG 87 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 776 WGGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGGPPHXRGE 648 +GGG GG GGG GGG G GG H E Sbjct: 77 YGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHGLNE 119 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFG 677 G GGG G GGG GGGG G G Sbjct: 76 GYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGG 108 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGG GGG G GG G G G Sbjct: 71 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 104 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 G GGGGG GG GG G G G G Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 103 >At3g07560.1 68416.m00903 glycine-rich protein Length = 304 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = -1 Query: 781 FXGGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 + GG GGGG GGGA G GG G+G G Sbjct: 125 YRGGYGGGGLYGSSGMY--GGGAMGGYGGTMGGYGMG 159 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 G G G G N GG GGGG G G G + G N Sbjct: 72 GYGDGNGNGNAHGRADCPGGIVVGGGGGGGGGGGGGGGSGGSN 114 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGGG G+ G G G+G G Sbjct: 96 GGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSG 130 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGG 695 GGGGGGG G G+ G GG Sbjct: 194 GGGGGGGGGGGGGVDGSGSGSGSGSGG 220 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGG 698 GGGGGGG G G+ GGG Sbjct: 196 GGGGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGGG GGG G G G G G Sbjct: 191 GGGGGGGGGG----GGGGGGVDGSGSGSGSGSGGG 221 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 696 PPPPXXAPPPXXXXXXXXFXPPPPPP 773 PPPP PPP PPPPPP Sbjct: 222 PPPP---PPPSQPLPRPLLLPPPPPP 244 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPP 720 PP Q P P PPP PP Sbjct: 244 PPQQPPATPPPPPPPPP 260 Score = 24.6 bits (51), Expect(2) = 1.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPP 725 P P P PPPP PPP Sbjct: 381 PPPSP---PPPPPPPPPP 395 Score = 24.6 bits (51), Expect(2) = 1.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 756 PPPPPPPXXL 785 PPPPPPP L Sbjct: 387 PPPPPPPPPL 396 >At5g10380.1 68418.m01204 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 301 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +3 Query: 750 FXPPPPPPP 776 + PPPPPPP Sbjct: 25 YPPPPPPPP 33 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 756 PPPPPPPXXL 785 PPPPPPP L Sbjct: 29 PPPPPPPREL 38 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 P P P PPP PPP PPPPP Sbjct: 365 PVPPPRRSPPPLQTPPPP---PPPPPLAPPPPP 394 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 699 PPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PPP +PPP PPPPPPP L Sbjct: 367 PPPRRSPPPLQT-------PPPPPPPPPL 388 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPP 725 PP P P PPPP APPP Sbjct: 368 PPRRSPPPLQTPPPPPPPPPLAPPP 392 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP 767 +PP G P PPP PPP PPPP Sbjct: 40 WPPFKWGPKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPP 79 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP--PPP 776 +PP + P P+ PPP PPP PPP PPP Sbjct: 107 YPPPIKKYPPPEQY--PPPIKKYPPPEQYSPPFKKYPPPEQYPPP 149 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP---PPP 773 P P P P PPP PPP + PP PPP Sbjct: 47 PKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPP 90 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/43 (32%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXP----PPPXXAPPPXXXXXXXXFXPPP 764 +PP + P P+ P PPP PPP PPP Sbjct: 120 YPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPP 162 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 +PP + P P PPP PPP PPPP Sbjct: 198 YPPPIK--KYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPP 236 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP----PPP 773 +PP + P P P PPP PPP PPP PPP Sbjct: 87 YPPPIKTYPHP-PVKYPPPEQY-PPPIKKYPPPEQYPPPIKKYPPP 130 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 8/50 (16%) Frame = +3 Query: 648 FPPXVXGXPX----PKPXXXPPPPXXAPPPXXXXXXXXFXPPP----PPP 773 +PP + P P P PPP PPP PPP PPP Sbjct: 159 YPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPP 208 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXA--PPPXXXXXXXXFXPPPP 767 +PP + P P P PPPP PP PPPP Sbjct: 218 YPPPIKTYPHP-PVKYPPPPYKTYPHPPIKTYPPPKECPPPP 258 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP----PPPP 776 +PP + P P+ PPP PPP PPP P PP Sbjct: 185 YPPPIKKYPPPEQY--PPPIKKYPPPIKKYPPPEEYPPPIKTYPHPP 229 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPP 765 SP PP P PPP PP G + + PPP Sbjct: 49 SPPPPSPPPPSTPTTACPPPPSPPSSGGGSSY--YYPPP 85 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAP---PPXXXXXXXXFXPPPPPP 773 PP P +P P P P PP + PPPPPP Sbjct: 382 PPPSQISPSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPPP 425 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 673 PXQNPXXPXPPPXXPP---PLXGXXXFXXFXPPPPPP 774 P P P P P PP P + PPPPPP Sbjct: 389 PSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPPP 425 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGGG G G GG G+G G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAG 606 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGG 695 GG GGG N G GA GGGG Sbjct: 64 GGASGGGYRNDGGRTGYGYGAGGGGGG 90 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGGG G G GG G+G G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAG 606 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGG 695 GG GGG N G GA GGGG Sbjct: 64 GGASGGGYRNDGGRTGYGYGAGGGGGG 90 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP PK PPPP P + PPPP P Sbjct: 32 PPVEVEENQPKTSPTPPPPHWMRYPPVLMPQMMYAPPPPMP 72 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGGG G G GG GFG G Sbjct: 115 GGGGGGGGFARRGGYGGGRGGYARGGFGRGGFGGG 149 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 651 PPXVXGXPXPK--PXXXPPP-PXXAPPPXXXXXXXXFXPPPPP 770 PP P P P PPP P +PPP P PPP Sbjct: 61 PPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 3/44 (6%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPP---PXXAPPPXXXXXXXXFXPPPPPPP 776 P P P PPP P PPP PPP PP Sbjct: 54 PDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPP 97 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGG 695 GGGG GG GGG GGGG Sbjct: 70 GGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GG GGGG GGG GGG G G Sbjct: 51 GGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGG 85 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGG G GGG GG G G G + GG Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGG 84 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGG GG GGG+ G G G G GG Sbjct: 54 GGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGG 95 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 24.6 bits (51), Expect(2) = 1.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 756 PPPPPPPXXL 785 PPPPPPP L Sbjct: 432 PPPPPPPPPL 441 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 684 PXXXPPPPXXAPPP 725 P PPPP PPP Sbjct: 427 PPPPPPPPPPPPPP 440 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP----PPP 776 FP P P PP P +PPP PPP PPP Sbjct: 1121 FPAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPP 1167 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP G P PPPP A PP + P P P Sbjct: 199 PPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGPYP 239 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 +PP P P PP P PPP PP P PP Sbjct: 190 YPPQPSAYPPPSTSGYPPIPSAYPPPPPSSA----YPPQPYPP 228 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 652 PRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPP 771 P+ G PP P P PP G PPPPP Sbjct: 179 PQPSGYPPASG-YPPQPSAYPPPSTSGYPPIPSAYPPPPP 217 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGG 698 GG GGGG GGGA GGG Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGG 37 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGG G G GA GGGG G G G Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGG 49 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP---XXAPPPXXXXXXXXFXPPPPPPP 776 PP P PK PPPP +PPP PPPP Sbjct: 460 PPPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 504 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPP---XXAPPPXXXXXXXXFXPPPPPPP 776 FPP P PK PPP +PPP PPPP Sbjct: 509 FPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPP 554 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 PP V P P PPP +PPP + PPP P Sbjct: 132 PPYVYSSPPPYVYSSPPPYAYSPPP------YAYSPPPSP 165 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP--XXAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PPP +PPP + PPP PP Sbjct: 385 PPYAYSPPPPCPDVYKPPPYVYSSPPP------YVYNPPPSSPP 422 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPX--XAPPPXXXXXXXXFXPPPPPPP 776 PP P P P PP +PPP PPPP P Sbjct: 353 PPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCP 396 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P KP PPP PPP P P PP Sbjct: 22 PPEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPP 56 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXG 653 G GGGG GGG G GG G G G + G Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGG 128 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = -1 Query: 781 FXGGGG-GGGXXNXXXXXXXGG---GAXXGGGGXXXGFGXGXP 665 F GGGG GGG GG G GGGG F G P Sbjct: 102 FGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEP 144 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPK-PXXXPPPPXXAPPPXXXXXXXXFXPPPP---PPP 776 PP V P PK P P PP PPP P PP PPP Sbjct: 167 PPQVPVKPHPKVPVISPDPPATLPPP----KVPVISPDPPTTLPPP 208 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 781 FXGGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 F GGGG G GGGA GG G G G G GG Sbjct: 39 FLGGGGSGDGLG----LGLGGGAGLGGLGIGAGIGAGAGLGLGG 78 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G GGG G G GA G GG G G G GG Sbjct: 52 GLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGG 93 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGG G G G G GGGG G G G GG Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGG 95 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGG GGG GGGG G G G Sbjct: 77 GGGGGGLGG-------GGGGLLGGGGFGGGAGGG 103 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXG 683 G GGGGG GGG GG G G Sbjct: 75 GLGGGGGGLGGGGGGLLGGGGFGGGAGGGLG 105 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 781 FXGGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 F GGGG G GGGA GG G G G G GG Sbjct: 39 FLGGGGSGDGLGLGL----GGGAGLGGLGIGAGIGAGAGLGLGG 78 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGG G G G G GGGG G G G Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGG 88 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 660 VXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 V P P P PP PPP PPPPPP Sbjct: 246 VAAPPLPPPGTAALPP---PPPLPMAAGKGVAAPPPPPP 281 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 25.8 bits (54), Expect(2) = 2.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +3 Query: 750 FXPPPPPPP 776 F PPPPPPP Sbjct: 327 FHPPPPPPP 335 Score = 22.6 bits (46), Expect(2) = 2.4 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 672 PXPKPXXXPPPPXXA 716 P P P PPPP A Sbjct: 280 PSPPPPPPPPPPLPA 294 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P G P PPPP PPP PPPP P Sbjct: 206 PPTTGLTLPHSPFPPPPP--GPPPKEQDFVRPPLPPPPQLP 244 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +3 Query: 648 FPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP--PPP 776 F P V P PPPP PP P PP PPP Sbjct: 342 FQPDVHPPPGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYGPPP 386 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP--XXAPPPXXXXXXXXFXPPPPPP 773 PP V P P P P P +PPP + PPPPP Sbjct: 342 PPYVYNSPPPPPYYSPSPTVNYKSPPP-----PYVYNSPPPPP 379 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP--PXXAPPPXXXXXXXXFXPPPPPP 773 PP + P P P P P +PPP + PPPPP Sbjct: 152 PPYIYSSPPPPPYYSPSPKVDYKSPPP-----PYVYSSPPPPP 189 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP--PXXAPPPXXXXXXXXFXPPPP 767 PP V P P P P P +PPP F PPPP Sbjct: 178 PPYVYSSPPPPPYYSPSPKVEYKSPPP---PYVYSFPPPPP 215 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPP--PXXAPPPXXXXXXXXFXPPPPPP 773 PP V P P P P P +PPP + PPPPP Sbjct: 368 PPYVYNSPPPPPYYSPFPKVEYKSPPP-----PYIYNSPPPPP 405 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP V P P P P P P + PPPPP Sbjct: 204 PPYVYSFPPPPPYYSPSPKVGYKSP---PAPYVYSSPPPPP 241 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 652 PRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPP 771 P G PP Q P PP PPP G PPP Sbjct: 512 PPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPP 551 >At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family protein sequencing discrepancy between cDNA and genomic sequence prevents representation of entire coding sequence Length = 578 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 660 VXGXPXPKPXXXPPPPX-XAPPPXXXXXXXXFXPPPPPPP 776 V P P+ PPPP APPP PPPP Sbjct: 469 VRSPPSPRSVMPPPPPKTIAPPPSKTMSPPSSKSMLPPPP 508 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 664 GGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPP 768 GGPP Q P PPP PP + G PPPP Sbjct: 239 GGPPPQRPPMGGPPP--PPHIGGS------APPPP 265 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGGG N GGG+ GGGG G G Sbjct: 61 GGGGGGSTGN------NGGGSGSGGGGGGFGGSGG 89 >At3g05220.2 68416.m00570 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 478 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGG N GG G GG G G P GG Sbjct: 305 GGGGGGNKGNHNHSAKGIGGGPMGPGGP---MGPGGPMGQGG 343 >At3g05220.1 68416.m00569 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 577 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGGGG N GG G GG G G P GG Sbjct: 404 GGGGGGNKGNHNHSAKGIGGGPMGPGGP---MGPGGPMGQGG 442 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 PP Q+ PPPL PPPPPP Sbjct: 608 PPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPP 642 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXA----PPPXXXXXXXXFXPPPPPPP 776 L P + P P P PPPP + P P PPPPPP Sbjct: 562 LKPLRILSRPPPPP---PPPPISSLRSTPSPSSTSNSIATQGPPPPPP 606 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGG----GGXXXGFGXGXP 665 GGG GG N GGG GG GG G+G P Sbjct: 143 GGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPP 183 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXA---PPPXXXXXXXXFXPPPPPPP 776 PP V P P P PPPP PPPPPPP Sbjct: 359 PPLVYSPPPPPP---PPPPFFQGLFSSKKGKSKKNNSNPPPPPPP 400 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGG GGG GGG GGGG G G G Sbjct: 59 GGGDGGGDGGGDG----GGGGCGGGGGCGGGGGGG 89 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPP----PPPP 776 PP V P PPP +PPP PPP PPP Sbjct: 35 PPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPP 80 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPP 767 P P PPP +PPP PPPP Sbjct: 378 PPPVKHYSPPPVYHSPPPPKEKYVYKSPPPPP 409 >At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 383 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 694 PXPPPXXPPPLXGXXXFXXFXPP----PPPP 774 P PPP PPP G PP PPPP Sbjct: 182 PPPPPHHPPPYGGYFSGSNGQPPLPVSPPPP 212 >At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 661 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 694 PXPPPXXPPPLXGXXXFXXFXPP----PPPP 774 P PPP PPP G PP PPPP Sbjct: 182 PPPPPHHPPPYGGYFSGSNGQPPLPVSPPPP 212 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 684 PXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P PPPP PPP PPPP PP Sbjct: 262 PPNRPPPPSSPPPPP---------PPPPTPP 283 >At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 713 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 770 GGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGG 669 GGGG K P GGG GG G G+ G Sbjct: 610 GGGGMNKFRRWGTPSSGGGGGRGGYGDSGYGGRG 643 >At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-containing protein similar to P58 protein, Bos primigenius taurus, PIR:A56534; similar to p58 (GI:1353270) {Homo sapiens}; contains Pfam PF00226: DnaJ domain; contains Pfam PF00515: TPR Domain Length = 482 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 8/40 (20%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGG--------GAXXGGGGXXXGFG 677 GGGGGG N GG G GGGG GFG Sbjct: 442 GGGGGGGYNPFHGGGGGGQQYTFHFEGGFPGGGGGFGGFG 481 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P PP APPP F PPP PP Sbjct: 26 PSNESSPPTPPSSPPPSSISAPPP---DISASFSPPPAPP 62 >At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family protein Length = 438 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P + P P P PP APP F PPPP P Sbjct: 186 PTQLQNTPAPVPVSTPPSQLQAPP-----AQSQFMPPPPAP 221 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPP--LXGXXXFXXFXPPPPPP 774 PP Q P P P PP L F PPPP P Sbjct: 185 PPTQLQNTPAPVPVSTPPSQLQAPPAQSQFMPPPPAP 221 >At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family protein Length = 496 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P + P P P PP APP F PPPP P Sbjct: 244 PTQLQNTPAPVPVSTPPSQLQAPP-----AQSQFMPPPPAP 279 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPP--LXGXXXFXXFXPPPPPP 774 PP Q P P P PP L F PPPP P Sbjct: 243 PPTQLQNTPAPVPVSTPPSQLQAPPAQSQFMPPPPAP 279 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 776 WGGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGGPP 663 WGGG GG GGG GG G G GGPP Sbjct: 58 WGGGMGG-----------GGGGGGGSGGGGGGRGGGPP 84 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGG 701 GGGGGGG + GGG GG Sbjct: 63 GGGGGGGGGSGGGGGGRGGGPPRGG 87 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P PK PPP PPP PPP P Sbjct: 120 PTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTP 153 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P PP P +P PPPPP Sbjct: 128 PPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPP 161 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGG GGG GGGG G G G Sbjct: 80 GGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSG 112 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G G GG N GGG GGGG G G G GG Sbjct: 43 GYGDNGGNYNNGGGYQGGGGNYQGGGGNYQG-GGGNYQGGGG 83 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGNK 644 GGGG GGG GGGG G G G GG + Sbjct: 66 GGGGNYQGGGGNYQGGGGRYQGGGGRYQG-GGGRYQGGGGRQ 106 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 769 GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GGGG GGG GGGG G G G GG Sbjct: 59 GGGGNYQGGGGNYQGGGGNYQGGGGRYQG-GGGRYQGGGG 97 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGF-GXGXP 665 G GGGGG G G GGG G+ G G P Sbjct: 26 GRGGGGGFVGSGNSPSIGSGYFGGGGNPGTGYMGGGIP 63 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPXPP---PXXPPPLXGXXXFXXFXPPPPPP 774 SP PP +P P P PPPL PPPPPP Sbjct: 33 SPSLSPSPPSSSPSSAPPSSLSPSSPPPLS----LSPSSPPPPPP 73 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPXPP---PXXPPPLXGXXXFXXFXPPPPPP 774 SP PP +P P P PPPL PPPPPP Sbjct: 82 SPSLSPSPPSSSPSSAPPSSLSPSSPPPLS----LSPSSPPPPPP 122 >At1g35880.1 68414.m04457 hypothetical protein Length = 222 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 773 GGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXG 672 GGGGGG GGG GGG G GFW G Sbjct: 163 GGGGGGNLGG-------GGGKFGGG-GDGGFWRG 188 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 8/39 (20%) Frame = +3 Query: 684 PXXXPPPPXXAPPPXXXXXXXXFXPPP--------PPPP 776 P PPPP A PP + PPP PPPP Sbjct: 26 PGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPP 64 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = -3 Query: 773 GGGGGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGGPPHXRG 651 G GGGG + G G GGG G+ G H RG Sbjct: 51 GRGGGGDRGRGYSGRGDGRGRGGGGDRGRGYSGRGDGHGRG 91 >At3g28630.1 68416.m03573 expressed protein contains Pfam profile: PF04601 protein of unknown function (DUF569 Length = 335 Score = 24.6 bits (51), Expect(2) = 4.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 756 PPPPPPPXXL 785 PPPPPPP L Sbjct: 197 PPPPPPPELL 206 Score = 23.0 bits (47), Expect(2) = 4.2 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +3 Query: 720 PPXXXXXXXXFXPPPPPP 773 PP PPPPPP Sbjct: 186 PPVAEPAYTPLPPPPPPP 203 >At3g28630.2 68416.m03574 expressed protein contains Pfam profile: PF04601 protein of unknown function (DUF569 Length = 303 Score = 24.6 bits (51), Expect(2) = 4.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 756 PPPPPPPXXL 785 PPPPPPP L Sbjct: 165 PPPPPPPELL 174 Score = 23.0 bits (47), Expect(2) = 4.3 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +3 Query: 720 PPXXXXXXXXFXPPPPPP 773 PP PPPPPP Sbjct: 154 PPVAEPAYTPLPPPPPPP 171 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PP P P PP +PP PPP P P L Sbjct: 151 PPSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPPPAPLPPSL 195 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 646 CSPRXXGGPPXQNPXXPXPPPXXPPP 723 C + PP Q P P PPP P P Sbjct: 356 CPIQFPASPPSQFPLPPPPPPPPPSP 381 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXG 683 GGGGGG N GGG+ GGGG G Sbjct: 61 GGGGGGSIGN------HGGGSGSGGGGGGYG 85 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 670 PPXQ-NPXXPXPPPXXPPPLXGXXXFXXFXPPPPP 771 PP Q P PPP P L F PPPPP Sbjct: 284 PPMQFRPPQGMPPPPPPQFLNHQQGFGGPRPPPPP 318 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 + PP + P P PPPP PP P PPPPP Sbjct: 281 MVPPPMQFRP---PQGMPPPP---PPQFLNHQQGFGGPRPPPPP 318 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGG 698 GG GGGG GGG+ GGG Sbjct: 16 GGSGGGGGSGDGSGSGDGGGSGDGGG 41 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -1 Query: 781 FXGGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFG 677 + GGGG GG + GGG GGGG G G Sbjct: 52 YQGGGGHGG--HGGGGYQGGGGRYQGGGGRQGGGG 84 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXP 665 GG GGG GGG G GG GFG G P Sbjct: 4 GGCGGGPGRGGRGFGGRGGGPGFGPGGP--GFGPGGP 38 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P P PP PPP P PPPP Sbjct: 58 PPPDSQLP-PLPSILPPLTDSPPPPSDSSPPVDSTPSPPPP 97 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GG GGGG GG GGG G G G Sbjct: 40 GGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHG 74 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGG---XXXGFGXGXPXTXGG 650 GGG GGG GGG GGG G G G + GG Sbjct: 39 GGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGG 83 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -1 Query: 775 GGGGG--GGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGGG GG GG GGG GFG G Sbjct: 57 GGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGG 93 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXG 671 GGGG G G G GGG GFG G Sbjct: 64 GGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGG 98 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 24.6 bits (51), Expect(2) = 5.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 756 PPPPPPPXXL 785 PPPPPPP L Sbjct: 264 PPPPPPPRPL 273 Score = 22.6 bits (46), Expect(2) = 5.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 750 FXPPPPPPP 776 F PP PPPP Sbjct: 256 FAPPTPPPP 264 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +3 Query: 645 LFPPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPP---PPPPP 776 L PP G P P PP P P PP PP PP Sbjct: 118 LGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPP 164 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P PPP PPP P PPP Sbjct: 28 PTATPPPATPPPVATPPPVATPPPAATPAPATPPP 62 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P + G P+ PP PPP PPPPPP Sbjct: 84 PQMFGQQQPQAFLPHLPPHHLPPPFPGPYDS--APPPPPP 121 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P + G P+ PP PPP PPPPPP Sbjct: 84 PQMFGQQQPQAFLPHLPPHHLPPPFPGPYDS--APPPPPP 121 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P + G P+ PP PPP PPPPPP Sbjct: 84 PQMFGQQQPQAFLPHLPPHHLPPPFPGPYDS--APPPPPP 121 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +3 Query: 654 PXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P + P P P PPPP +P P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLP 200 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP V P P PPP PPP PPP P Sbjct: 50 PPPVMS---PMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMP 87 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXG 683 GGGGG GGG GGGG G Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGF 680 GGGGG GGG GGG GF Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDGGGGF 153 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -1 Query: 781 FXGG-GGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGGN 647 F GG GGGG + GG GG G G G + GG+ Sbjct: 510 FGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGGGSYGGS 555 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/42 (30%), Positives = 16/42 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 GG GGG G + GGG G+G + GG Sbjct: 507 GGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGG 548 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 672 PXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 P P P PP PPP + P PPPP Sbjct: 20 PYPAPYR-PPSSEPYPPPPTNQYSAPYYPYPPPP 52 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 696 PPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 PPPP P P PPP PP L Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPPVSL 222 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = -1 Query: 781 FXGGGGGGGXXNXXXXXXXGGGAXXGG---GGXXXGFGXG 671 + GG GG G N GGG GG GG G G G Sbjct: 41 YNGGHGGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGGHG 80 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPP 773 PP P P PP P APP PPPPP Sbjct: 39 PPQQHSQPPVAPLV-PPGPPYAPPAQIPSSLLPTNLPPPPP 78 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXTXGG 650 G G GG GG A GGG GFG GG Sbjct: 850 GSGTGGFGGFAPQGSSGGFAGAAGGGGFGGFGGQAQGQAGG 890 >At4g37180.2 68417.m05264 myb family transcription factor contains Pfam domain, PF00249: Myb-like DNA-binding domain Length = 363 Score = 24.6 bits (51), Expect(2) = 7.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 756 PPPPPPPXXL 785 PPPPPPP L Sbjct: 169 PPPPPPPAPL 178 Score = 22.2 bits (45), Expect(2) = 7.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 750 FXPPPPPPP 776 F PPPPPP Sbjct: 166 FNRPPPPPP 174 >At4g37180.1 68417.m05263 myb family transcription factor contains Pfam domain, PF00249: Myb-like DNA-binding domain Length = 356 Score = 24.6 bits (51), Expect(2) = 7.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 756 PPPPPPPXXL 785 PPPPPPP L Sbjct: 162 PPPPPPPAPL 171 Score = 22.2 bits (45), Expect(2) = 7.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 750 FXPPPPPPP 776 F PPPPPP Sbjct: 159 FNRPPPPPP 167 >At5g57290.1 68418.m07157 60S acidic ribosomal protein P3 (RPP3B) Length = 120 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGG 695 GGGGGGG GGGA GGGG Sbjct: 70 GGGGGGG-------FAAGGGAAAGGGG 89 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 696 PPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PPPP A PPPPPPP Sbjct: 118 PPPPSTAVEYQPHHRHHPPPPPPPPPP 144 >At5g13760.1 68418.m01604 expressed protein similar to unknown protein (gb AAF63775.1) Length = 569 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 PP P PPPP P P PPPP Sbjct: 73 PPPNLAQPLRSSSRQPPPPPPRPQTPPTFVPEETQPQTPPPP 114 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +3 Query: 684 PXXXPPPPXXAPPPXXXXXXXXFXPPPPP 770 P P P +PPP PPPPP Sbjct: 44 PPPSKPSPSMSPPPSPSLPLSSSPPPPPP 72 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 651 PPXVXGXPXPKPXXXPPPP---XXAPPPXXXXXXXXFXPPPPPPP 776 PP + P PK PPP +PPP PPPP Sbjct: 637 PPPLYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVTYKSPPPP 681 >At4g15460.1 68417.m02363 glycine-rich protein Length = 148 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -3 Query: 773 GGG----GGGXKXXXXXXPXRGGGXXGGGXGXXGFWXGGPPHXRG 651 GGG GGG GGG GGG G G GG RG Sbjct: 68 GGGHASVGGGHASGGGGHAVEGGGHAGGGGGGHGEEEGGHGIGRG 112 >At4g09270.1 68417.m01535 hypothetical protein same aa sequence as protein T8A17_30 because of location on repetitive section Length = 100 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 684 PXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P P A P PPPPPPP Sbjct: 46 PQAAPAPAPTAQQPEENVLPQQQQPPPPPPP 76 >At4g09220.1 68417.m01528 hypothetical protein Length = 100 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 684 PXXXPPPPXXAPPPXXXXXXXXFXPPPPPPP 776 P P P A P PPPPPPP Sbjct: 46 PQAAPAPAPTAQQPEENVLPQQQQPPPPPPP 76 >At3g46740.1 68416.m05074 chloroplast outer envelope protein, putative similar to chloroplastic outer envelope membrane protein (OEP75) [Pisum sativum] GI:633607; contains Pfam profile PF01103: outer membrane protein, OMP85 family Length = 818 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGG 695 GGGGGG N GGG GG Sbjct: 102 GGGGGGDGNFGGFGGGGGGGDGNDGG 127 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 6/48 (12%) Frame = +3 Query: 651 PPXVXGXPXPK-PXXXPPPPXXAPPPXXXXXXXXFXPPP-----PPPP 776 PP + P PK PPPP +P P PPP PPPP Sbjct: 56 PPPLEYSPAPKVDYKSPPPPYYSPSPKVEYKS---PPPPYVYNSPPPP 100 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +1 Query: 670 PPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPPP 774 PP Q P PP PP + PP P P Sbjct: 341 PPYQMQSYPPNPPRQQPPAGSTPSQQFYNPPQPQP 375 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGGXXXG 683 GGGGGG GGG+ GGGG G Sbjct: 12 GGGGGGCGGGGSSG--GGGSSGGGGGGPCG 39 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 678 PKPXXXPPPPXXAPPPXXXXXXXXFXPPPPPPPXXL 785 P P PP P P PP PPPP L Sbjct: 88 PPPPPSPPHPNPFFPSSDPTSTASHPPPAPPPPASL 123 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +1 Query: 649 SPRXXGGPPXQNPXXPXPPPXXPPPLXGXXXFXXFXPPPPP 771 +P PP + P PPP P G PPP P Sbjct: 251 APTPSPPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPPAP 291 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGGXXXGFGXGXPXT 659 GG GGG GGG GGG G G G T Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGGGMT 817 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +3 Query: 651 PPXVXGX--PXPKPX-XXPPPPXXAPPP 725 PP G P P P PPPP APPP Sbjct: 645 PPSAMGMMQPPPMPGMAPPPPPEEAPPP 672 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 Query: 775 GGGGGGGXXNXXXXXXXGGGAXXGGGG 695 GGGGGGG + G GA GGGG Sbjct: 193 GGGGGGGAGS---YGGGGAGAGSGGGG 216 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 772 GGGGGGXXNXXXXXXXGGGAXXGGGG 695 GGGGGG GG + GGGG Sbjct: 65 GGGGGGGGRGGGGARSGGRSRGGGGG 90 >At5g66960.1 68418.m08442 prolyl oligopeptidase family protein similar to OpdB [Treponema denticola] GI:13786054; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF02897: Prolyl oligopeptidase, N-terminal beta-propeller domain Length = 792 Score = 24.6 bits (51), Expect(2) = 8.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 756 PPPPPPPXXL 785 PPPPPPP L Sbjct: 30 PPPPPPPPAL 39 Score = 21.8 bits (44), Expect(2) = 8.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 681 KPXXXPPPPXXAPPP 725 KP PPPP PPP Sbjct: 25 KPPKSPPPP--PPPP 37 >At2g39250.1 68415.m04820 AP2 domain-containing transcription factor, putative AP2_ARATH Floral homeotic protein APETALA2.(SP:P47927){Arabidopsis thaliana} Length = 222 Score = 23.8 bits (49), Expect(2) = 9.6 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 756 PPPPPPP 776 PPPPPPP Sbjct: 60 PPPPPPP 66 Score = 22.6 bits (46), Expect(2) = 9.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 696 PPPPXXAPPP 725 PPPP PPP Sbjct: 56 PPPPPPPPPP 65 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,362,117 Number of Sequences: 28952 Number of extensions: 262268 Number of successful extensions: 13943 Number of sequences better than 10.0: 213 Number of HSP's better than 10.0 without gapping: 1137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6788 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2324382072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -