BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_H10 (535 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47370.2 68416.m05151 40S ribosomal protein S20 (RPS20B) 40S ... 176 7e-45 At3g47370.1 68416.m05150 40S ribosomal protein S20 (RPS20B) 40S ... 176 7e-45 At5g62300.1 68418.m07821 40S ribosomal protein S20 (RPS20C) ribo... 175 2e-44 At3g45030.1 68416.m04851 40S ribosomal protein S20 (RPS20A) 40S ... 175 2e-44 At3g13120.1 68416.m01642 30S ribosomal protein S10, chloroplast,... 56 1e-08 At1g20530.1 68414.m02558 hypothetical protein 30 1.1 At2g01940.1 68415.m00129 zinc finger (C2H2 type) family protein ... 27 5.9 At3g18310.1 68416.m02330 expressed protein 27 7.9 >At3g47370.2 68416.m05151 40S ribosomal protein S20 (RPS20B) 40S RIBOSOMAL PROTEIN S20 - ARABIDOPSIS THALIANA,PID:g1350956 Length = 122 Score = 176 bits (429), Expect = 7e-45 Identities = 78/109 (71%), Positives = 97/109 (88%) Frame = +3 Query: 144 QAXVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPC 323 +A + IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PC Sbjct: 14 EAPLEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPC 73 Query: 324 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 470 GEG+ TWDRF++R+HKRVIDL S ++VKQITSI IEPGVEVEVTIAD+ Sbjct: 74 GEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >At3g47370.1 68416.m05150 40S ribosomal protein S20 (RPS20B) 40S RIBOSOMAL PROTEIN S20 - ARABIDOPSIS THALIANA,PID:g1350956 Length = 122 Score = 176 bits (429), Expect = 7e-45 Identities = 78/109 (71%), Positives = 97/109 (88%) Frame = +3 Query: 144 QAXVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPC 323 +A + IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTRK PC Sbjct: 14 EAPLEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPC 73 Query: 324 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 470 GEG+ TWDRF++R+HKRVIDL S ++VKQITSI IEPGVEVEVTIAD+ Sbjct: 74 GEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >At5g62300.1 68418.m07821 40S ribosomal protein S20 (RPS20C) ribosomal protein S20, Arabidopsis thaliana, PIR:T12992 Length = 124 Score = 175 bits (425), Expect = 2e-44 Identities = 79/113 (69%), Positives = 99/113 (87%) Frame = +3 Query: 132 IEQPQAXVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTR 311 +E+P + IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTR Sbjct: 15 LEEP---LEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTR 71 Query: 312 KTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 470 K PCGEG+ TWDRF++R+HKRVIDL S ++VKQITSI IEPGVEVEVTIAD+ Sbjct: 72 KAPCGEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 124 >At3g45030.1 68416.m04851 40S ribosomal protein S20 (RPS20A) 40S ribsomomal proteinS20, Arabidopsis thaliana, pir:T12992 Length = 124 Score = 175 bits (425), Expect = 2e-44 Identities = 79/113 (69%), Positives = 99/113 (87%) Frame = +3 Query: 132 IEQPQAXVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTR 311 +E+P + IH+IRITL+S+NV++LEKVC DL+ GAK ++LRVKGPVRMPTK+L+ITTR Sbjct: 15 LEEP---LEQIHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTR 71 Query: 312 KTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 470 K PCGEG+ TWDRF++R+HKRVIDL S ++VKQITSI IEPGVEVEVTIAD+ Sbjct: 72 KAPCGEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 124 >At3g13120.1 68416.m01642 30S ribosomal protein S10, chloroplast, putative similar to 30S ribosomal protein S10 GB:P02364 [Escherichia coli] (est matches suggest the N-terminal extension) Length = 191 Score = 56.0 bits (129), Expect = 1e-08 Identities = 34/120 (28%), Positives = 61/120 (50%), Gaps = 1/120 (0%) Frame = +3 Query: 105 AAAVVSGKXIEQPQAXVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMP 284 A+ V S I ++P +IRI L S V +E C +++ A+ + GPV +P Sbjct: 73 ASEVPSSSSISVDADKMAPKQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLP 132 Query: 285 TKILRITTRKTPCGEGSKTWDRFQMRIHKRVID-LHSPSEIVKQITSINIEPGVEVEVTI 461 TK K+P + F++R H+R+ID L+ ++ + + +++ GV+VEV + Sbjct: 133 TKKRIYCVLKSPHVHKDARF-HFEIRTHQRMIDILYPTAQTIDSLMQLDLPAGVDVEVKL 191 >At1g20530.1 68414.m02558 hypothetical protein Length = 614 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -2 Query: 384 GRSLSCGFASENDPRSLNLHHKEFYGW*YAGSWLACGLGPLHAASVSW 241 G +C S + P SLNL+H FY Y + P ++ +W Sbjct: 106 GEGTNCDLLSGSKPESLNLNHDSFYSRRYESGTITPPPPPPAPSNYAW 153 >At2g01940.1 68415.m00129 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 439 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +2 Query: 5 FQKFLETCGFSGSALXNFCLXSCFSRPXFNKQHGSRCSVRQXHRATP 145 ++ L+TCG G + C FSR +H CS R+ HR P Sbjct: 160 YKAHLKTCGTRGHSCD--C-GRVFSRVESFIEHQDNCSARRVHREPP 203 >At3g18310.1 68416.m02330 expressed protein Length = 873 Score = 27.1 bits (57), Expect = 7.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 236 WSQETEAACKGPSPHANQDPA 298 W+ +++ C GPSP +DP+ Sbjct: 400 WNAQSQMFCFGPSPSVGKDPS 420 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,388,923 Number of Sequences: 28952 Number of extensions: 210534 Number of successful extensions: 450 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -