BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32098 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38207| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_59063| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_57588| Best HMM Match : Vicilin_N (HMM E-Value=1.4) 28 5.3 SB_52932| Best HMM Match : Ank (HMM E-Value=0) 28 5.3 SB_26631| Best HMM Match : ig (HMM E-Value=1.6e-22) 27 6.9 >SB_38207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 201 PPSAHQFRYARCRWKSRNCSCKLPSGLASNSD 106 PPS R+ W +R CS L G+ SN + Sbjct: 105 PPSEGAKRHEFATWHARGCSADLEKGVKSNEE 136 >SB_59063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 74 PPTEDYPKIVRSEFDASPDGSLQLQFRDF 160 PP D + S++D S GS Q++FR F Sbjct: 199 PPVCDIDGDLSSDYDGSSSGSSQIRFRPF 227 >SB_57588| Best HMM Match : Vicilin_N (HMM E-Value=1.4) Length = 756 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 197 GGSRRRQQASRYCCCA 244 GGSRRR S++CC A Sbjct: 97 GGSRRRNSKSKFCCFA 112 >SB_52932| Best HMM Match : Ank (HMM E-Value=0) Length = 1266 Score = 27.9 bits (59), Expect = 5.3 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +3 Query: 159 SNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFADET 311 S + + TG K LDD KPHV+ ++ SY D E + ET Sbjct: 204 SKTVTKMFTGFRKLTLDDLRKPHVVKDIQ-SYILNRLDDDSELRKHLTRET 253 >SB_26631| Best HMM Match : ig (HMM E-Value=1.6e-22) Length = 1123 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 241 CVEATVTRTLTANLKPLRTSLTRLDT 318 C T +T N KP +TSLTRL++ Sbjct: 348 CPVDTKAMNITVNYKPEKTSLTRLES 373 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,442,074 Number of Sequences: 59808 Number of extensions: 250497 Number of successful extensions: 788 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -