BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32083 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44060.1 68416.m04720 F-box family protein contains F-box dom... 27 5.7 At1g48120.1 68414.m05370 calcineurin-like phosphoesterase family... 27 5.7 At1g18990.1 68414.m02362 expressed protein contains Pfam profile... 27 5.7 At5g22070.1 68418.m02570 expressed protein contains Pfam profile... 27 9.9 >At3g44060.1 68416.m04720 F-box family protein contains F-box domain Pfam:PF00646 Length = 427 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 136 PAPMELTTTISRLPTASCVAKL 201 P M+LT + +LPTASC K+ Sbjct: 403 PKKMQLTEDLLKLPTASCKLKI 424 >At1g48120.1 68414.m05370 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 1338 Score = 27.5 bits (58), Expect = 5.7 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +3 Query: 156 NYNFETSNGIVR---SETGELKEALDDD-NKPHVIVAVRGSYSYTNTDGKPETIT 308 +++ +T NG SET E+ + L D KP RG+Y TD K ++ T Sbjct: 1053 DFSDKTENGSKEADHSETAEISKDLSDTVGKPESCSRTRGTYEAIGTDAKLKSNT 1107 >At1g18990.1 68414.m02362 expressed protein contains Pfam profile PF04576: Protein of unknown function, DUF593 Length = 524 Score = 27.5 bits (58), Expect = 5.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 180 GIVRSETGELKEALDDDNKP 239 G++R E GE +E LD++ KP Sbjct: 401 GLLREERGEAEEFLDEETKP 420 >At5g22070.1 68418.m02570 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 362 Score = 26.6 bits (56), Expect = 9.9 Identities = 19/59 (32%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = +3 Query: 6 TSRXRTKTIKNEIDHRCSSRPCGYRHRCPPTEDY-PKIVRSEFDASPDGAYNYNFETSN 179 T R TIK+ I R PC C P E Y P ++ + PDG Y N Sbjct: 248 TRRHALLTIKDRILWRKFKLPCYRSDECYPEEHYFPTLLNMK---DPDGCTGYTLTRVN 303 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,863,054 Number of Sequences: 28952 Number of extensions: 176359 Number of successful extensions: 492 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -