BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31484 (449 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13180.1 68416.m01649 NOL1/NOP2/sun family protein / antiterm... 27 4.4 At3g13400.1 68416.m01685 multi-copper oxidase type I family prot... 27 5.9 >At3g13180.1 68416.m01649 NOL1/NOP2/sun family protein / antitermination NusB domain-containing protein low similarity to SP|P36929 SUN protein (FMU protein) {Escherichia coli}; contains Pfam profiles PF01189: NOL1/NOP2/sun family, PF01029: NusB family Length = 523 Score = 27.5 bits (58), Expect = 4.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 24 LAICLSLTVALAAETGKYTPFQYNRVYSTVSPF 122 +A LS V L+AET K +P + R T PF Sbjct: 1 MAQLLSFRVYLSAETQKASPGSFKRTQKTRKPF 33 >At3g13400.1 68416.m01685 multi-copper oxidase type I family protein similar to pollen-specific BP10 protein [SP|Q00624][Brassica napus]; contains Pfam profile: PF00394 Multicopper oxidase Length = 551 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 30 ICLSLTVALAAETGKYTPFQYNRVYSTVSP 119 +CL+ TVAL + Y + +N Y T +P Sbjct: 11 VCLASTVALVSAGDPYFYYTWNVTYGTAAP 40 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,321,531 Number of Sequences: 28952 Number of extensions: 135490 Number of successful extensions: 418 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 418 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -