BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31476 (617 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03110.1 68416.m00307 exportin 1, putative strong similarity ... 30 1.4 >At3g03110.1 68416.m00307 exportin 1, putative strong similarity to Exportin1 (XPO1) protein [Arabidopsis thaliana] GI:7671510; contains Pfam profile PF03810: Importin-beta N-terminal domain Length = 1076 Score = 29.9 bits (64), Expect = 1.4 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 6/95 (6%) Frame = +3 Query: 9 ILLQFYVTI*KDIYKMHSDHEENYKFAACTFFAKSHPGETCGSNGLPL---TPSSIS--- 170 +L+Q+ + IY H DHE+ K + +K GE N L SIS Sbjct: 454 VLVQYKIMRETLIYLSHLDHEDTEK-QMLSKLSKQLSGEEWAWNNLNTLCWAIGSISGSM 512 Query: 171 ILGRAQRLLSIEHPNLCTYLDIIRGKHGKVVVSQN 275 ++ + R L + +L + ++++GK K V++ N Sbjct: 513 VVEQENRFLVMVIRDLLSLCEVVKGKDNKAVIASN 547 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,736,856 Number of Sequences: 28952 Number of extensions: 240356 Number of successful extensions: 487 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -