BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31467 (732 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50580.1 68416.m05532 proline-rich family protein contains pr... 40 0.001 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 36 0.037 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 35 0.048 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 35 0.048 At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-conta... 35 0.048 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 35 0.064 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 35 0.064 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 34 0.085 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 34 0.085 At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identic... 34 0.085 At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identic... 34 0.085 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 34 0.085 At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identic... 34 0.11 At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica... 34 0.11 At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica... 34 0.11 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 34 0.11 At5g61090.1 68418.m07665 proline-rich family protein contains pr... 33 0.15 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 33 0.15 At3g24550.1 68416.m03083 protein kinase family protein contains ... 33 0.15 At1g26150.1 68414.m03192 protein kinase family protein similar t... 33 0.15 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 33 0.20 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 33 0.20 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 33 0.26 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 33 0.26 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 32 0.34 At4g21670.1 68417.m03139 double-stranded RNA-binding domain (DsR... 32 0.34 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 32 0.34 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 32 0.34 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 32 0.34 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 32 0.45 At5g38560.1 68418.m04662 protein kinase family protein contains ... 31 0.60 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 31 0.60 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 31 0.60 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 31 0.60 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 31 0.79 At1g23540.1 68414.m02960 protein kinase family protein contains ... 31 0.79 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 31 1.0 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 31 1.0 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 31 1.0 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 31 1.0 At1g13050.1 68414.m01513 expressed protein 31 1.0 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 30 1.4 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 30 1.4 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 30 1.4 At2g18470.1 68415.m02151 protein kinase family protein contains ... 30 1.4 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 30 1.4 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 30 1.4 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 30 1.8 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 30 1.8 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 30 1.8 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 30 1.8 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 30 1.8 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 30 1.8 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 30 1.8 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 30 1.8 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 30 1.8 At4g11260.1 68417.m01822 phosphatase-related low similarity to p... 30 1.8 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 30 1.8 At3g10070.1 68416.m01207 transcription initiation factor IID (TF... 30 1.8 At5g55020.1 68418.m06853 myb family transcription factor (MYB120... 29 2.4 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 29 2.4 At3g46620.1 68416.m05061 zinc finger (C3HC4-type RING finger) fa... 29 2.4 At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein ... 29 2.4 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 29 2.4 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 29 2.4 At2g27100.1 68415.m03256 C2H2 zinc-finger protein SERRATE (SE) i... 29 2.4 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 29 2.4 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 29 2.4 At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family... 29 2.4 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 2.4 At1g08060.2 68414.m00881 MOM1 identical to MOM1 (mutation in a '... 29 2.4 At1g08060.1 68414.m00880 MOM1 identical to MOM1 (mutation in a '... 29 2.4 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 29 2.4 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 29 3.2 At3g32904.1 68416.m04164 hypothetical protein 29 3.2 At3g07130.1 68416.m00849 serine/threonine protein phosphatase fa... 29 3.2 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 29 3.2 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 29 3.2 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 29 3.2 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 29 3.2 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 29 3.2 At1g10620.1 68414.m01204 protein kinase family protein contains ... 29 3.2 At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family... 29 4.2 At4g01810.1 68417.m00238 protein transport protein-related relat... 29 4.2 At3g57380.1 68416.m06387 expressed protein contains Pfam domain,... 29 4.2 At3g24860.1 68416.m03118 hydroxyproline-rich glycoprotein family... 29 4.2 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 29 4.2 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 29 4.2 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 29 4.2 At1g75340.1 68414.m08751 zinc finger (CCCH-type) family protein ... 29 4.2 At1g61080.1 68414.m06877 proline-rich family protein 29 4.2 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 29 4.2 At1g49270.1 68414.m05524 protein kinase family protein contains ... 29 4.2 At1g49190.1 68414.m05515 two-component responsive regulator fami... 29 4.2 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 29 4.2 At5g58040.1 68418.m07263 fip1 motif-containing protein contains ... 28 5.6 At5g56980.1 68418.m07112 expressed protein non-consensus CG dono... 28 5.6 At5g56890.1 68418.m07099 protein kinase family protein contains ... 28 5.6 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 28 5.6 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 28 5.6 At3g16770.1 68416.m02141 AP2 domain-containing protein RAP2.3 (R... 28 5.6 At2g41870.1 68415.m05177 remorin family protein contains Pfam do... 28 5.6 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 28 5.6 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 28 5.6 At1g78310.1 68414.m09126 VQ motif-containing protein contains PF... 28 5.6 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 28 5.6 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 28 5.6 At1g03780.1 68414.m00359 targeting protein-related similar to mi... 28 5.6 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 28 5.6 At4g36080.1 68417.m05136 FAT domain-containing protein / phospha... 28 7.3 At3g18810.1 68416.m02389 protein kinase family protein contains ... 28 7.3 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 28 7.3 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 28 7.3 At5g55310.1 68418.m06893 DNA topoisomerase I, putative similar t... 27 9.7 At5g52680.1 68418.m06540 heavy-metal-associated domain-containin... 27 9.7 At5g16100.1 68418.m01881 hypothetical protein 27 9.7 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 27 9.7 At5g11510.1 68418.m01343 myb family transcription factor (MYB3R4... 27 9.7 At5g01040.1 68418.m00007 laccase family protein / diphenol oxida... 27 9.7 At4g19570.1 68417.m02877 DNAJ heat shock N-terminal domain-conta... 27 9.7 At4g18760.1 68417.m02772 leucine-rich repeat family protein cont... 27 9.7 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 27 9.7 At4g14990.1 68417.m02303 expressed protein 27 9.7 At3g44200.1 68416.m04739 protein kinase family protein contains ... 27 9.7 At3g24540.1 68416.m03082 protein kinase family protein contains ... 27 9.7 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 27 9.7 At2g40760.1 68415.m05028 rhodanese-like domain-containing protei... 27 9.7 At2g17930.1 68415.m02076 FAT domain-containing protein / phospha... 27 9.7 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 27 9.7 At1g14920.1 68414.m01783 gibberellin response modulator (GAI) (R... 27 9.7 At1g12970.1 68414.m01506 leucine-rich repeat family protein 27 9.7 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 40.3 bits (90), Expect = 0.001 Identities = 34/112 (30%), Positives = 53/112 (47%) Frame = +2 Query: 320 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSST 499 ++P +PIP+ +TP +P P P P P+ +P PPS P + + T SPS Sbjct: 75 ISPSTPIPSTPSTP--SPPPPAPKKSPPPPTPKKSPSPPS-LTPFV--PHPTPKKSPSPP 129 Query: 500 RTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNH 655 T + + P +TP LP ++ P P S+ H +P+ PP+H Sbjct: 130 PTPSLPPPAPKKSP--STP-SLPPPTPKKSPPPPPSH--HSSSPS--NPPHH 174 Score = 30.7 bits (66), Expect = 1.0 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 TP P P P S +P TPS PP+ + S P P P + P Sbjct: 114 TPFVPH-PTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPP 158 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 35.5 bits (78), Expect = 0.037 Identities = 21/50 (42%), Positives = 24/50 (48%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 457 S P A P P A+ P P PLPP P S P++TP PP P L Sbjct: 123 SPPPPAITPPPPLATTPPALPPKPLPP----PLSPPQTTPPPPPAITPPL 168 Score = 34.7 bits (76), Expect = 0.064 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 P SP P A+ P P PLPP P S P++TP PP P Sbjct: 72 PPQSTSPPPVATTPPALPPKPLPP----PLSPPQTTPPPPPAITP 112 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 356 TPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 457 +P +P PLPP P P++TP PP P L Sbjct: 257 SPTISPPPLPPQTLKPPP-PQTTPPPPPAITPPL 289 Score = 29.1 bits (62), Expect = 3.2 Identities = 32/111 (28%), Positives = 39/111 (35%), Gaps = 3/111 (2%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP-SQFQPQLDGEYRTYLLSPSSTR 502 P P P P T P PP+ P P+ST PP + P L + LSP T Sbjct: 46 PPQPDPQPPTPP--TFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTT 103 Query: 503 TDETIDESIQSQPYRTTPLVLPGAKVRREP--GPTESYLRHHPNPAMRAPP 649 + P T PL P + P T L P P +PP Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPP 154 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 35.1 bits (77), Expect = 0.048 Identities = 29/97 (29%), Positives = 41/97 (42%) Frame = +2 Query: 323 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTR 502 +P SP ++S+T +P+P P P P STP PP +F P T +P Sbjct: 84 SPPSPTDSSSSTSI-SPNP-PAPIVNPNPPPPSTPNPPPEFSPPPPDLDTT--TAPPPPS 139 Query: 503 TDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYL 613 TD I P +P + P + V P P + L Sbjct: 140 TDIPIPPP-PPAPVSASPPLTPPSSVVTSPAPVHAKL 175 Score = 29.5 bits (63), Expect = 2.4 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +2 Query: 308 SGTPLAPRSPIP--NASATPFRTPSPLPPSWRGPESLPRST-PVPPS 439 S T ++P P P N + P TP+P P P L +T P PPS Sbjct: 93 SSTSISPNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPS 139 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 35.1 bits (77), Expect = 0.048 Identities = 30/118 (25%), Positives = 50/118 (42%), Gaps = 1/118 (0%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQ-FQPQLDGEYRTYLLSPS 493 P P +P+P A++ P+P S G S P P P S+ + D + S Sbjct: 819 PPKPVTPLPPATSPMANAPTP-SSSESGEISTPVQAPTPDSEDIEAPSDSNHSPVFKSSP 877 Query: 494 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRD 667 + D + +++ + P V A + E P+ S +P+P + APP+ D D Sbjct: 878 APSPDS--EPEVEAPVPSSEPEV--EAPKQSEATPSSSPPSSNPSPDVTAPPSEDNDD 931 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +2 Query: 314 TPLAPRSPIPNA----SATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 TP SP P + P +P P PP P+ P PP Q QP Sbjct: 543 TPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQP 592 Score = 28.7 bits (61), Expect = 4.2 Identities = 27/120 (22%), Positives = 42/120 (35%), Gaps = 2/120 (1%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 496 P SP P P +P P PP P+ P PP Q P+ + + + Sbjct: 517 PKPEESPKPEPPK-PEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQET 575 Query: 497 TRTDET--IDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDT 670 + +E+ Q QP +T + G+ P P + Y PP+ +T Sbjct: 576 PKPEESPKPQPPKQEQPPKTEAPKM-GSPPLESPVPNDPYDASPIKKRRPQPPSPSTEET 634 Score = 27.9 bits (59), Expect = 7.3 Identities = 26/123 (21%), Positives = 43/123 (34%), Gaps = 7/123 (5%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTY--- 478 S P P+ P P +P P PP P+ P PP Q P+ + + Sbjct: 533 SPKPQPPKQETPK----PEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPK 588 Query: 479 LLSPSSTRTDE----TIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAP 646 P T + ++ + + PY +P+ +R P P + ++P Sbjct: 589 QEQPPKTEAPKMGSPPLESPVPNDPYDASPI------KKRRPQPPSPSTEETKTTSPQSP 642 Query: 647 PNH 655 P H Sbjct: 643 PVH 645 >At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226: DnaJ domain Length = 797 Score = 35.1 bits (77), Expect = 0.048 Identities = 36/132 (27%), Positives = 45/132 (34%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRT 505 P + P S P T P+P S S P PP FQ + S S Sbjct: 519 PTTSKPFVSQPP-NTSKPMPVSQPPTTSKPLPVSQPPPTFQSTCPSQPPAASSSLSPLPP 577 Query: 506 DETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDTLMKQK 685 +S QS P TTP +P A P P PA A P H + T ++ Sbjct: 578 VFNSTQSFQSPPVSTTPSAVPEASTIPSP----------PAPAPVAQPTHVFNQTPPPEQ 627 Query: 686 VAESVLQRVVGE 721 +S R E Sbjct: 628 TPKSGAARTDSE 639 Score = 30.3 bits (65), Expect = 1.4 Identities = 30/119 (25%), Positives = 46/119 (38%) Frame = +2 Query: 341 PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETID 520 P++++ PF P P S P S PR P S QP P+++++ Sbjct: 458 PSSNSKPFPVSQPQPASNPFPVSQPRPNSQPFSMSQPSSTARPFPASQPPAASKSFPISQ 517 Query: 521 ESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDTLMKQKVAES 697 S+P+ + P +P PT S P P + PP ++ T Q A S Sbjct: 518 PPTTSKPFVSQPPNTSKPMPVSQP-PTTS----KPLPVSQPPPT--FQSTCPSQPPAAS 569 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 34.7 bits (76), Expect = 0.064 Identities = 30/113 (26%), Positives = 37/113 (32%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 496 P P P P + P +P P PP P P P PP + P Y + PS Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPP-PPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Query: 497 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNH 655 T P+ P + P P E Y P P +PP H Sbjct: 528 APTPVYCTRPPPPPPHSPPP-------PQFSPPPPEPYYYSSPPPPHSSPPPH 573 Score = 31.1 bits (67), Expect = 0.79 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 2/72 (2%) Frame = +2 Query: 242 KNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPS--WRGPESLP 415 + +P Q K + R G G ++PR P+ P PSP PP+ + P +L Sbjct: 366 QRSPGQCKAFLSRPPVNCGSFSCGRSVSPRPPVVTPLPPP-SLPSPPPPAPIFSTPPTL- 423 Query: 416 RSTPVPPSQFQP 451 ++P PPS P Sbjct: 424 -TSPPPPSPPPP 434 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 +P P P P + P P P PP P P P PP + P Sbjct: 437 SPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSP 482 Score = 29.5 bits (63), Expect = 2.4 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 6/52 (11%) Frame = +2 Query: 314 TPLAPRS-PIPNASATPFRTP----SPLPPSWRGPE-SLPRSTPVPPSQFQP 451 TPL P S P P A F TP SP PPS P S P P PP + P Sbjct: 400 TPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSP 451 Score = 29.1 bits (62), Expect = 3.2 Identities = 28/111 (25%), Positives = 32/111 (28%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 496 P P P P S P P P PP + P P P PP P + Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPP 498 Query: 497 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 649 + S P P V P PT Y P P +PP Sbjct: 499 PPPPPPPPPPVYSPP---PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP 546 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLP--RSTPVPP 436 +P P +P+ + TP +P P PP P P +P PP Sbjct: 590 SPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPP 632 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 34.7 bits (76), Expect = 0.064 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 317 PLAPRS-PIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 P AP+ P P+ P TP P+PP P+ P TP P + P Sbjct: 90 PPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAP 135 Score = 30.3 bits (65), Expect = 1.4 Identities = 30/117 (25%), Positives = 40/117 (34%), Gaps = 4/117 (3%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRST----PVPPSQFQPQLDGEYRT 475 S P+AP P A P +P P PP P+ P + P PP + QP+ Sbjct: 9 SPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPAC 68 Query: 476 YLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAP 646 P E + P P+ P + P PT + H P AP Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPP--KPPAPTPKPVPPHGPPPKPAP 123 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 436 P P+ P P P P P P P P+ P PP Sbjct: 99 PSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 34.3 bits (75), Expect = 0.085 Identities = 36/111 (32%), Positives = 49/111 (44%), Gaps = 1/111 (0%) Frame = +2 Query: 320 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRS-TPVPPSQFQPQLDGEYRTYLLSPSS 496 L+P+ P P A R+ SP PPS R LPRS +P P + +P L P+S Sbjct: 127 LSPKPPSPRAEVP--RSLSPKPPSPRA--DLPRSLSPKPFDRSKPSSASANAPPTLRPAS 182 Query: 497 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 649 TR + SQ R TP +P + G + + P P+ RA P Sbjct: 183 TR--------VPSQ--RITPHSVPSPRPSSPRGASPQAISSKP-PSPRAEP 222 Score = 33.5 bits (73), Expect = 0.15 Identities = 42/142 (29%), Positives = 57/142 (40%), Gaps = 5/142 (3%) Frame = +2 Query: 320 LAPRSP-IPNASATPFRTPSPLPPSWRG--PESLPRSTPVPPSQFQPQLDGEYRTYLLSP 490 L P S +P+ TP PSP P S RG P+++ P P ++ P LD R Sbjct: 178 LRPASTRVPSQRITPHSVPSPRPSSPRGASPQAISSKPPSPRAE-PPTLDTP-RPPSPRA 235 Query: 491 SSTRTD-ETIDESIQSQPYRTTPLV-LPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYR 664 +S R D +D + + P +PL P R P R P P + AP R Sbjct: 236 ASLRADPPRLDAARPTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDP-PRLDAP-----R 289 Query: 665 DTLMKQKVAESVLQRVVGEKHL 730 T K SV R V + + Sbjct: 290 PTTPKPPSPRSVSPRAVQRREI 311 Score = 28.7 bits (61), Expect = 4.2 Identities = 22/48 (45%), Positives = 24/48 (50%), Gaps = 7/48 (14%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTP---SPLPPSWRG-PESL--PR-STPVPPS 439 P PR P P A A P +P PPS R P L PR +TP PPS Sbjct: 250 PTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDPPRLDAPRPTTPKPPS 297 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 34.3 bits (75), Expect = 0.085 Identities = 36/111 (32%), Positives = 49/111 (44%), Gaps = 1/111 (0%) Frame = +2 Query: 320 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRS-TPVPPSQFQPQLDGEYRTYLLSPSS 496 L+P+ P P A R+ SP PPS R LPRS +P P + +P L P+S Sbjct: 126 LSPKPPSPRAEVP--RSLSPKPPSPRA--DLPRSLSPKPFDRSKPSSASANAPPTLRPAS 181 Query: 497 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 649 TR + SQ R TP +P + G + + P P+ RA P Sbjct: 182 TR--------VPSQ--RITPHSVPSPRPSSPRGASPQAISSKP-PSPRAEP 221 Score = 33.5 bits (73), Expect = 0.15 Identities = 42/142 (29%), Positives = 57/142 (40%), Gaps = 5/142 (3%) Frame = +2 Query: 320 LAPRSP-IPNASATPFRTPSPLPPSWRG--PESLPRSTPVPPSQFQPQLDGEYRTYLLSP 490 L P S +P+ TP PSP P S RG P+++ P P ++ P LD R Sbjct: 177 LRPASTRVPSQRITPHSVPSPRPSSPRGASPQAISSKPPSPRAE-PPTLDTP-RPPSPRA 234 Query: 491 SSTRTD-ETIDESIQSQPYRTTPLV-LPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYR 664 +S R D +D + + P +PL P R P R P P + AP R Sbjct: 235 ASLRADPPRLDAARPTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDP-PRLDAP-----R 288 Query: 665 DTLMKQKVAESVLQRVVGEKHL 730 T K SV R V + + Sbjct: 289 PTTPKPPSPRSVSPRAVQRREI 310 Score = 28.7 bits (61), Expect = 4.2 Identities = 22/48 (45%), Positives = 24/48 (50%), Gaps = 7/48 (14%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTP---SPLPPSWRG-PESL--PR-STPVPPS 439 P PR P P A A P +P PPS R P L PR +TP PPS Sbjct: 249 PTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDPPRLDAPRPTTPKPPS 296 >At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identical to gi_11935086_gb_AAG41963 Length = 162 Score = 34.3 bits (75), Expect = 0.085 Identities = 20/94 (21%), Positives = 38/94 (40%), Gaps = 1/94 (1%) Frame = +2 Query: 320 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP-VPPSQFQPQLDGEYRTYLLSPSS 496 ++P +P P ++ P +TP P P P STP + P P+ D + + Sbjct: 46 ISPAAPTPESTEAPAKTPVEAPVE-APPSPTPASTPQISPPAPSPEADTPSAPEIAPSAD 104 Query: 497 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGP 598 +++ ++T P P +++ P P Sbjct: 105 VPAPALTKHKKKTKKHKTAPAPGPASELLSPPAP 138 >At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identical to gi_11935086_gb_AAG41963 Length = 185 Score = 34.3 bits (75), Expect = 0.085 Identities = 20/94 (21%), Positives = 38/94 (40%), Gaps = 1/94 (1%) Frame = +2 Query: 320 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP-VPPSQFQPQLDGEYRTYLLSPSS 496 ++P +P P ++ P +TP P P P STP + P P+ D + + Sbjct: 46 ISPAAPTPESTEAPAKTPVEAPVE-APPSPTPASTPQISPPAPSPEADTPSAPEIAPSAD 104 Query: 497 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGP 598 +++ ++T P P +++ P P Sbjct: 105 VPAPALTKHKKKTKKHKTAPAPGPASELLSPPAP 138 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 34.3 bits (75), Expect = 0.085 Identities = 20/40 (50%), Positives = 23/40 (57%) Frame = +2 Query: 332 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 SP P+ SA P R+P PP P SLP+ TP PP F P Sbjct: 225 SPPPSPSAPPPRSP---PPKSSPPSSLPQ-TPSPPLVFTP 260 >At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identical to gi|10880497|gb|AAG24278; supported by Ceres cDNA 265772 Length = 127 Score = 33.9 bits (74), Expect = 0.11 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 PR+ P S TP TP+P P S P +P+P S P Sbjct: 40 PRTAAPTPSITPTPTPTPSATPTAAPVSPPAGSPLPSSASPP 81 Score = 31.9 bits (69), Expect = 0.45 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 TP +P P SATP T +P+ P P S P PP+ P Sbjct: 46 TPSITPTPTPTPSATP--TAAPVSPPAGSPLPSSASPPAPPTSLTP 89 >At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1102 Score = 33.9 bits (74), Expect = 0.11 Identities = 28/104 (26%), Positives = 38/104 (36%), Gaps = 4/104 (3%) Frame = +2 Query: 338 IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETI 517 +P S P + P+ P P P TP P S QP + + P+ D+ Sbjct: 832 VPQVSHPPMQQPTMFMPHQAQPAPQPSFTPAPTSNAQPSMRTTF-VPSTPPALKNADQYQ 890 Query: 518 DESIQSQ----PYRTTPLVLPGAKVRREPGPTESYLRHHPNPAM 637 ++ S P V PG GP S L +PNP M Sbjct: 891 QPTMSSHSFTGPSNNAYPVPPGPGQYAPSGP--SQLGQYPNPKM 932 Score = 28.3 bits (60), Expect = 5.6 Identities = 28/119 (23%), Positives = 43/119 (36%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 493 T P +P +A ++ P+ S+ GP + P P Q+ P + Y +P Sbjct: 873 TTFVPSTPPALKNADQYQQPTMSSHSFTGPSNNAYPVPPGPGQYAPSGPSQLGQY-PNPK 931 Query: 494 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDT 670 + I P TP V P + P ++ + P PA PP DT Sbjct: 932 MPQVVAPAAGPIGFTP-MATPGVAPRSVQPASPPTQQAAAQAAPAPA-TPPPTVQTADT 988 >At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1104 Score = 33.9 bits (74), Expect = 0.11 Identities = 28/104 (26%), Positives = 38/104 (36%), Gaps = 4/104 (3%) Frame = +2 Query: 338 IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETI 517 +P S P + P+ P P P TP P S QP + + P+ D+ Sbjct: 834 VPQVSHPPMQQPTMFMPHQAQPAPQPSFTPAPTSNAQPSMRTTF-VPSTPPALKNADQYQ 892 Query: 518 DESIQSQ----PYRTTPLVLPGAKVRREPGPTESYLRHHPNPAM 637 ++ S P V PG GP S L +PNP M Sbjct: 893 QPTMSSHSFTGPSNNAYPVPPGPGQYAPSGP--SQLGQYPNPKM 934 Score = 28.3 bits (60), Expect = 5.6 Identities = 28/119 (23%), Positives = 43/119 (36%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 493 T P +P +A ++ P+ S+ GP + P P Q+ P + Y +P Sbjct: 875 TTFVPSTPPALKNADQYQQPTMSSHSFTGPSNNAYPVPPGPGQYAPSGPSQLGQY-PNPK 933 Query: 494 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDT 670 + I P TP V P + P ++ + P PA PP DT Sbjct: 934 MPQVVAPAAGPIGFTP-MATPGVAPRSVQPASPPTQQAAAQAAPAPA-TPPPTVQTADT 990 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 33.9 bits (74), Expect = 0.11 Identities = 36/117 (30%), Positives = 44/117 (37%), Gaps = 3/117 (2%) Frame = +2 Query: 320 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSST 499 + P P P+ P TPSP PPS P P TP PP P Y SP Sbjct: 608 VTPSPPPPSPLYYPPVTPSPPPPS---PVYYPPVTPSPP----PPSPVYYPPVTPSPPPP 660 Query: 500 RTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHP---NPAMRAPPNHDY 661 E+ QS P T P + P PT++ HP P+ PP + Y Sbjct: 661 SPVYYPSET-QSPPPPTEYYYSPS----QSPPPTKACKEGHPPQATPSYEPPPEYSY 712 Score = 32.3 bits (70), Expect = 0.34 Identities = 18/40 (45%), Positives = 20/40 (50%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 436 P+ P P P+ P TPSP PPS P P TP PP Sbjct: 622 PVTPSPPPPSPVYYPPVTPSPPPPS---PVYYPPVTPSPP 658 Score = 31.9 bits (69), Expect = 0.45 Identities = 32/111 (28%), Positives = 44/111 (39%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 496 P+ P P+ P TPSP PPS P P TP PP P Y ++PS Sbjct: 592 PVTYSPPPPSPVYYPQVTPSPPPPS---PLYYPPVTPSPP----PPSPVYYPP--VTPSP 642 Query: 497 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 649 + P +P+ P ++ + P PTE Y +P+ PP Sbjct: 643 PPPSPVYYPPVTPSPPPPSPVYYP-SETQSPPPPTEYYY----SPSQSPPP 688 >At5g61090.1 68418.m07665 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; common family members: At4g18570, At3g25690, At4g04980 [Arabidopsis thaliana] Length = 344 Score = 33.5 bits (73), Expect = 0.15 Identities = 32/132 (24%), Positives = 55/132 (41%), Gaps = 1/132 (0%) Frame = +2 Query: 254 NQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 433 +++KL+ + + G+G ++P P A AT + P +PPS R PE+ PRS P Sbjct: 57 SKVKLLSPEEAMKLTSGGNGVAVSPVKP---ARATS-QVPKRVPPS-RTPEA-PRSVPAC 110 Query: 434 PSQFQPQ-LDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESY 610 P P+ + P + R I + ++P ++P P P + Sbjct: 111 PIPEIPRPVPARPTPETPRPVTARPTPEIPRPVPARPISEVQTLVPTRPTSTAPSPVSA- 169 Query: 611 LRHHPNPAMRAP 646 HP + +P Sbjct: 170 ---HPTSVVPSP 178 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 33.5 bits (73), Expect = 0.15 Identities = 27/88 (30%), Positives = 38/88 (43%), Gaps = 2/88 (2%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSP--LPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSP 490 P+ +P P+ ++P TPS PPS S P S P PPS P L SP Sbjct: 117 PVLAAAPSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPS---PSLPPSSLPPSASP 173 Query: 491 SSTRTDETIDESIQSQPYRTTPLVLPGA 574 + T ++ E++ P P + P A Sbjct: 174 PTNGTPDS--ETLTPPPAPLPPSLSPNA 199 Score = 31.1 bits (67), Expect = 0.79 Identities = 22/48 (45%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSP-LPPSWR-GPESLPRSTPVPPSQFQP 451 TP P SP P+ +TP PSP PPS P SLP S PP+ P Sbjct: 134 TPSTPSSP-PSTPSTPSSPPSPPSPPSPSLPPSSLPPSAS-PPTNGTP 179 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 33.5 bits (73), Expect = 0.15 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPR-STPVPPSQFQP 451 +P AP +P P + TP SP P+ +GP + P STP PS +P Sbjct: 81 SPSAPITPSPPSPTTPSNPRSPPSPN-QGPPNTPSGSTPRTPSNTKP 126 Score = 31.9 bits (69), Expect = 0.45 Identities = 23/56 (41%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +2 Query: 332 SPIPNASATP-FRTPSPLPPS-WRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 493 +P P AS+ P TPS PPS S P S+P+PPS P G L PS Sbjct: 26 TPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPS 81 Score = 30.3 bits (65), Expect = 1.4 Identities = 26/69 (37%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = +2 Query: 305 GSGTPLAPRSPIPNASATPFRTPSPLPPS-WRGPESLPRSTPVPPSQFQPQLDGEYRTYL 481 GS TP P+ P P+A TP PSP PS R P S + P PS P+ + Sbjct: 71 GSLTPPLPQ-PSPSAPITP-SPPSPTTPSNPRSPPSPNQGPPNTPSGSTPRTPSNTKP-- 126 Query: 482 LSPSSTRTD 508 SP S +D Sbjct: 127 -SPPSDSSD 134 Score = 29.5 bits (63), Expect = 2.4 Identities = 28/103 (27%), Positives = 38/103 (36%) Frame = +2 Query: 344 NASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDE 523 + + +P TPSP PPS P + +TP P + P T P S T+ T Sbjct: 2 STAPSPGTTPSPSPPS--PPTNSTTTTPPPAASSPPPT----TTPSSPPPSPSTNSTSPP 55 Query: 524 SIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPN 652 P P PG+ P P+ S P+ P N Sbjct: 56 PSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSN 98 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 33.5 bits (73), Expect = 0.15 Identities = 37/119 (31%), Positives = 44/119 (36%), Gaps = 2/119 (1%) Frame = +2 Query: 299 LRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTY 478 L G P SP P S P PP+ P S+P PP P + T Sbjct: 82 LTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPP----PPTEAPPTTP 137 Query: 479 LLSPSSTRTDETIDESIQSQPYRTTPL-VLPGAKVRREPGPTESYLRHHPN-PAMRAPP 649 + SPS ES S P P LP K+ P+ S RH P+ PA PP Sbjct: 138 ITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKL---VPPSHSPPRHLPSPPASEIPP 193 Score = 31.5 bits (68), Expect = 0.60 Identities = 30/116 (25%), Positives = 41/116 (35%), Gaps = 2/116 (1%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRG--PESLPRSTPVPPSQFQPQLDGEYRTYL 481 + TP P ++P PSP PS G P ++P S P PS P L E Sbjct: 54 TNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSP-PPPLPTEAPPPA 112 Query: 482 LSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 649 SS + + ++ TTP+ P P P P+P P Sbjct: 113 NPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLP 168 Score = 30.7 bits (66), Expect = 1.0 Identities = 33/123 (26%), Positives = 43/123 (34%), Gaps = 7/123 (5%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDG--EYRTYLLSP 490 P P S P S+ P P+ PP+ P + P PP + P L L P Sbjct: 111 PANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPP 170 Query: 491 SSTRTDETIDESIQSQPYRTTP-----LVLPGAKVRREPGPTESYLRHHPNPAMRAPPNH 655 + + S P P L P A R P++S HP+P PP H Sbjct: 171 KLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDS---EHPSP---PPPGH 224 Query: 656 DYR 664 R Sbjct: 225 PKR 227 Score = 29.9 bits (64), Expect = 1.8 Identities = 27/110 (24%), Positives = 40/110 (36%) Frame = +2 Query: 323 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTR 502 AP P +S P +P P PP+ P + P ++P PP+ P + P+ Sbjct: 108 APPPANPVSSPPPESSPPPPPPT-EAPPTTPITSPSPPTNPPPPPESPPSL----PAPDP 162 Query: 503 TDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPN 652 + P + P LP P P RH P+P P+ Sbjct: 163 PSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPP----RHLPSPPASERPS 208 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/49 (32%), Positives = 19/49 (38%) Frame = +2 Query: 305 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 GS P P P P+ S P P PP P P P+P + P Sbjct: 235 GSKRP-TPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSP 282 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 33.1 bits (72), Expect = 0.20 Identities = 30/119 (25%), Positives = 48/119 (40%) Frame = +1 Query: 316 ATSATFAHTQRKRHTIQDSKPVASVMAWSGISASQHTGATFAIPATTGRRIQNLSAVAFF 495 A ++ + +Q R ++ ++P S S A + AT PAT ++ S V+ Sbjct: 161 APASAPSKSQPPRSSVSPAQPPKSSSPISHTPALSPSHATSHSPATPSPSPKSPSPVSHS 220 Query: 496 HAHR*DHR*VYSESAVPHHSSRAPGS*GPKGAWPHRELPASSPQPSNEGTS*PRLP*YP 672 +H H +S + P HS S P A H A S P++ + P P P Sbjct: 221 PSHSPAHTPSHSPAHTPSHSPAHAPSHSPAHAPSHSPAHAPSHSPAHSPSHSPATPKSP 279 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 33.1 bits (72), Expect = 0.20 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 7/56 (12%) Frame = +2 Query: 311 GTPLAPRSPIPN----ASATPFRTPSPLPPSWRGPESLPR---STPVPPSQFQPQL 457 G+P +P SP P+ + TP P+P+ P P +P + P PPS P L Sbjct: 544 GSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPL 599 Score = 32.3 bits (70), Expect = 0.34 Identities = 38/117 (32%), Positives = 48/117 (41%), Gaps = 5/117 (4%) Frame = +2 Query: 311 GTPLAPR-SPIPNASA-TPFRTPSP--LPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTY 478 G+P +P SP P + +P TPSP PPS S P +TP P S P T Sbjct: 421 GSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGS---PPTSPTTPTP 477 Query: 479 LLSPSSTRTDETIDESIQSQPYRTTP-LVLPGAKVRREPGPTESYLRHHPNPAMRAP 646 SP S+ T T S S P TP P + PG + P+P + P Sbjct: 478 GGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVP 534 Score = 31.9 bits (69), Expect = 0.45 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +2 Query: 305 GSGTPLAPRSPIPNASA-TPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 G P +P +P P S +P +PSP P + P S P S PPS P Sbjct: 504 GGSPPSSPTTPSPGGSPPSPSISPSP-PITVPSPPSTPTSPGSPPSPSSP 552 Score = 28.7 bits (61), Expect = 4.2 Identities = 31/112 (27%), Positives = 41/112 (36%), Gaps = 1/112 (0%) Frame = +2 Query: 323 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTR 502 +P +P+ +TP SP PS P S S P P + P G+ SP Sbjct: 528 SPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQN-----SPPIIP 582 Query: 503 TDETIDESIQSQPYRTTPLVLPGAKVRREPGPT-ESYLRHHPNPAMRAPPNH 655 + S S P P V+P + GPT S P P P+H Sbjct: 583 SPPFTGPSPPSSPSPPLPPVIPSPPI---VGPTPSSPPPSTPTPGTLLHPHH 631 Score = 28.3 bits (60), Expect = 5.6 Identities = 21/68 (30%), Positives = 28/68 (41%) Frame = +2 Query: 296 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT 475 G G G P +P+ TP +P PPS S P + P PP+ P + Sbjct: 396 GSFGCGRSTRPPVVVPSPPTTP--SPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPS 453 Query: 476 YLLSPSST 499 + SP ST Sbjct: 454 IVPSPPST 461 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 32.7 bits (71), Expect = 0.26 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 320 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 439 + P P P+ + P TP+P PS P + + P PPS Sbjct: 198 VTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPS 237 Score = 31.1 bits (67), Expect = 0.79 Identities = 33/113 (29%), Positives = 40/113 (35%), Gaps = 2/113 (1%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRST-PVPPSQFQPQLDGEYRTYLLS-P 490 P+ P SP P + P TP PP S+P T PV P P T +S P Sbjct: 77 PVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 136 Query: 491 SSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 649 T T + P TP P P PT+ + P P PP Sbjct: 137 PPTPTPSVPSPTPPVSPPPPTP--TPSVPSPTPPVPTDP-MPSPPPPVSPPPP 186 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 P +P P+ + P TP+P PS P P TP PP+ P Sbjct: 185 PPTPTPSVPSPPDVTPTPPTPSVPSP---PDVTPTPPTPSVP 223 Score = 30.3 bits (65), Expect = 1.4 Identities = 32/113 (28%), Positives = 44/113 (38%), Gaps = 1/113 (0%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRST-PVPPSQFQPQLDGEYRTYLLSPS 493 P++P P P S P TP PP S+P T PV P P T +SP Sbjct: 96 PVSPPPPTPTPSV-PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 154 Query: 494 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPN 652 ++ + P T P+ P V P PT P P++ +PP+ Sbjct: 155 PPTPTPSVPS--PTPPVPTDPMPSPPPPV-SPPPPT-------PTPSVPSPPD 197 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/49 (38%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLP-PSWRGPESLPRSTPVPPSQFQP 451 S TP P P+P + P P P P PS P P TP PP+ P Sbjct: 164 SPTPPVPTDPMP-SPPPPVSPPPPTPTPSVPSP---PDVTPTPPTPSVP 208 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 32.7 bits (71), Expect = 0.26 Identities = 36/125 (28%), Positives = 49/125 (39%) Frame = +2 Query: 275 QRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 454 +R E R +G RSP+P +P R SP P R P S R P + +P Sbjct: 213 RRPRETSPQRKTGLSPRRRSPLPRRGLSP-RRRSPDSPHRRRPGSPIRRRGDTPPRRRP- 270 Query: 455 LDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPA 634 SPS R+ + P R +P + G+ VRR P R P Sbjct: 271 ---------ASPSRGRSPSSPPPRRYRSPPRGSPRRIRGSPVRRR-SPLPLRRRSPPPRR 320 Query: 635 MRAPP 649 +R+PP Sbjct: 321 LRSPP 325 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 32.3 bits (70), Expect = 0.34 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 3/67 (4%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRST---PVPPSQFQPQLDGEYRTYLLS 487 P+ R+P+P P R +PLPP P ++ R P PP P D E Sbjct: 33 PMRRRAPLPPPPPPPMRRRAPLPPP--PPPAMRRRVLPRPPPPPPPLPMFDAEVLCCCYP 90 Query: 488 PSSTRTD 508 P+ R + Sbjct: 91 PTRVRRE 97 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 436 P P P P R +PLPP P + R P+PP Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPP--PPPPMRRRAPLPP 56 >At4g21670.1 68417.m03139 double-stranded RNA-binding domain (DsRBD)-containing protein contains Pfam profile PF00035: Double-stranded RNA binding motif Length = 981 Score = 32.3 bits (70), Expect = 0.34 Identities = 30/111 (27%), Positives = 45/111 (40%), Gaps = 6/111 (5%) Frame = +2 Query: 341 PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYL------LSPSSTR 502 P ASA+ P P+ + + + P P Q QPQ +L L S R Sbjct: 514 PMASASSVSVPVPVQVVQQAIQPSAMAFPSIPFQ-QPQQPTSIAKHLVPSEPSLQSSPAR 572 Query: 503 TDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNH 655 + + ES R L+L + R+P P+E P ++APP+H Sbjct: 573 EEGEVPESELDPDTRRRLLILQHGQDTRDPAPSEPSFPQ--RPPVQAPPSH 621 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 32.3 bits (70), Expect = 0.34 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +2 Query: 317 PLAPRSPIPNASATPFR--TPSPLPPSWRGPESLPRSTPVPP 436 P+ P P P+ + P R TP P PP + E R TP PP Sbjct: 135 PITPSPPPPSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSPP 176 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +2 Query: 320 LAPRSPIPNASATPFR--TPSPLPPSWRGPESLPRSTPVPP 436 + P P P+ + R TPSP PPS S P + P PP Sbjct: 119 ITPSPPPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPP 159 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.3 bits (70), Expect = 0.34 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV--PPSQFQPQLDGEYRTYLLSP 490 P P P S P P P P + P LP TP+ PP F P + Y SP Sbjct: 55 PPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPPQAYQAYYYRKSP 111 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 32.3 bits (70), Expect = 0.34 Identities = 38/126 (30%), Positives = 52/126 (41%), Gaps = 3/126 (2%) Frame = +2 Query: 281 DVEREG-LRGSGTPLAPR--SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 D E++G R L+PR SP+P +P R SP P R P S R P + +P Sbjct: 205 DAEKDGGPRRPRERLSPRRRSPLPRRGLSP-RRRSPDSPHRRRPGSPIRRRGDTPPRRRP 263 Query: 452 QLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNP 631 SPS R+ + P R +P + G+ VRR P R P Sbjct: 264 ----------ASPSRGRSPSSPPPRRYRSPPRGSPRRIRGSPVRRR-SPLPLRRRSPPPR 312 Query: 632 AMRAPP 649 +R+PP Sbjct: 313 RLRSPP 318 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 31.9 bits (69), Expect = 0.45 Identities = 31/116 (26%), Positives = 40/116 (34%), Gaps = 4/116 (3%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP---PSQFQPQLDGEYRTYLL 484 TP P P P+ P P P P + P P TP P P+ P + T + Sbjct: 127 TPKPPTKPPPSTPKPPTTKPPPSTP--KPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPV 184 Query: 485 SPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLR-HHPNPAMRAPP 649 T T + + P T P P V P PT + P P + PP Sbjct: 185 ITPPTPTPPVVTPPTPTPPVITPP--TPTPPVITPPTPTPPVVTPPTPTPPVVTPP 238 Score = 30.3 bits (65), Expect = 1.4 Identities = 30/115 (26%), Positives = 41/115 (35%), Gaps = 4/115 (3%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 496 P + P P P P P PP + P P STP PP++ P P + Sbjct: 94 PPTVKPPHPKPPTKPH--PHPKPPIVKPPTKPPPSTPKPPTKPPPSTP--------KPPT 143 Query: 497 TRTDETIDESIQSQPYRT---TPLVLPGAKVRREPGPTESYLR-HHPNPAMRAPP 649 T+ + + +P T P P V P PT + P P + PP Sbjct: 144 TKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPP 198 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 31.5 bits (68), Expect = 0.60 Identities = 31/115 (26%), Positives = 41/115 (35%), Gaps = 2/115 (1%) Frame = +2 Query: 308 SGTPLAPRSPIPN--ASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYL 481 S P+ SP P +S P +P P PP P S+P PP T Sbjct: 47 SPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTP 106 Query: 482 LSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAP 646 +P T + ++ S P TT P PG T S P+P +P Sbjct: 107 PAPPQTVSPPPPPDASPSPPAPTTTNP-PPKPSPSPPGETPSPPGETPSPPKPSP 160 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +2 Query: 479 LLSPSSTRTDETIDESIQSQPYRTT--PLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 649 +LSP S+ + T +Q+QP + P V P + P P S P P + +PP Sbjct: 9 ILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVS--SSPPPPVVSSPP 65 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 31.5 bits (68), Expect = 0.60 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 454 P+ R P+P P R +P PP G P P PP F P+ Sbjct: 16 PMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPP---PPPPPMFDPK 58 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 31.5 bits (68), Expect = 0.60 Identities = 28/117 (23%), Positives = 45/117 (38%), Gaps = 12/117 (10%) Frame = +2 Query: 341 PNASATPFRTP---SPLPPSWRGPESLPR--STPVPPSQFQPQLDGEYRTYLLSPSSTRT 505 P ++ P++ P +P PS++ P P+ P P S + P+ Y+ P+ R Sbjct: 296 PPSNPPPYQAPQTQTPHQPSYQSPPQQPQYPQQPPPSSGYNPEEQPPYQMQSYPPNPPRQ 355 Query: 506 DETIDESIQSQ---PYRTTPLVLPGAKVRREPGPTESYL----RHHPNPAMRAPPNH 655 + Q P + P + GA R G YL + +P A P H Sbjct: 356 QPPAGSTPSQQFYNPPQPQPSMYDGAGGRSNSGFPSGYLSEPYTYSGSPMSSAKPPH 412 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 31.5 bits (68), Expect = 0.60 Identities = 27/73 (36%), Positives = 32/73 (43%), Gaps = 6/73 (8%) Frame = +2 Query: 299 LRGSGTPLAPRSPIPNASATPFRTPSP--LPPSWRGPESLPRSTPVP----PSQFQPQLD 460 L S P P S P +S +P +PSP PS P SL S+P P PS P Sbjct: 63 LSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPP 122 Query: 461 GEYRTYLLSPSST 499 LSPSS+ Sbjct: 123 SSSPLSSLSPSSS 135 Score = 31.1 bits (67), Expect = 0.79 Identities = 25/78 (32%), Positives = 31/78 (39%) Frame = +2 Query: 332 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDE 511 SP P +S+ PS L PS P SL S+P PP L + SP S+ Sbjct: 37 SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSS 96 Query: 512 TIDESIQSQPYRTTPLVL 565 S+ P PL L Sbjct: 97 APPSSL--SPSSPPPLSL 112 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 31.1 bits (67), Expect = 0.79 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +2 Query: 329 RSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 457 R+ +AS +P+ PSP P GP P P PP P L Sbjct: 86 RNLAESASFSPWPAPSPSPFPNGGPIESPAYPPAPPRPIPPHL 128 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 31.1 bits (67), Expect = 0.79 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 317 PLAPRSPIPNASATPF-RTPSPLPPSWRGPESLPRSTPVPPS 439 PL P P+ S+ P TPSP PP+ S P + PP+ Sbjct: 73 PLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPA 114 Score = 29.5 bits (63), Expect = 2.4 Identities = 26/89 (29%), Positives = 34/89 (38%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLS 487 S TP AP + + + P + PPS P P + PP Q P T S Sbjct: 109 SETPPAPPNESNDNNPPPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAPPASDPTN--S 166 Query: 488 PSSTRTDETIDESIQSQPYRTTPLVLPGA 574 P ++ D T IQ T+P P A Sbjct: 167 PPASPLDPTNPPPIQPSGPATSPPANPNA 195 Score = 29.1 bits (62), Expect = 3.2 Identities = 28/113 (24%), Positives = 43/113 (38%), Gaps = 5/113 (4%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPP---SWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 496 P +P N++ P + P PP S P S P STP P SQ P P Sbjct: 23 PETPSENSALPPVDSSPPSPPADSSSTPPLSEP-STPPPDSQLPPLPSILPPLTDSPPPP 81 Query: 497 TRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPA--MRAPP 649 + + +D + P + P P P ++P P+ +++PP Sbjct: 82 SDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPP 134 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 433 + TP AP + P+ + +P P+ PP+ GP P S P P Sbjct: 63 AATP-APATTPPSVAPSPADVPTASPPAPEGPTVSPSSAPGP 103 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 439 TP +P P A+ P TP+P P P + P PPS Sbjct: 36 TPPPVATPPPVATPPPAATPAPATPP---PAATPAPATTPPS 74 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +2 Query: 326 PRSPI-PNASATPFRTPS-PLPPSWRGPESLPRSTPVPPS 439 P P+ P+ S +P P P PP G ES P P+PP+ Sbjct: 92 PMMPMTPSTSPSPLTVPDMPSPPMPSGMESSPSPGPMPPA 131 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 PL+P P + ++P R P P P + LP +PP F P Sbjct: 38 PLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPP 82 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 436 PL PR +P P P PP PE PR P PP Sbjct: 68 PLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPP 107 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 30.7 bits (66), Expect = 1.0 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLL 484 P SP P P PSP PP P LP P P P D + + LL Sbjct: 73 PPSP-PPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLPFASSLL 124 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 439 P SP P P P P PP P P P PPS Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPS 84 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 436 P P P P + P P P PP P LP +PP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 >At1g13050.1 68414.m01513 expressed protein Length = 317 Score = 30.7 bits (66), Expect = 1.0 Identities = 24/76 (31%), Positives = 33/76 (43%) Frame = +2 Query: 341 PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETID 520 P++ P R PLPP P S R + P + +P +R Y P+ R T Sbjct: 68 PSSRPLPLRPEEPLPPR-HNPNS-ARPLQLSPEEQRP----PHRGYGSEPTPWRRAPT-R 120 Query: 521 ESIQSQPYRTTPLVLP 568 + Q P RT P+ LP Sbjct: 121 PAYQQGPKRTKPMTLP 136 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQ 442 P P+SP P S+ P P PP+ + S PV P++ Sbjct: 164 PTRPKSPPPRKSSFPPSRSPPPPPAKKNASKNSTSAPVSPAK 205 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 332 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 SP P+ S P R+ P P R PR + PPS+ P Sbjct: 145 SPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPP 184 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQ 442 P P+SP P S+ P P PP+ + S PV P++ Sbjct: 164 PTRPKSPPPRKSSFPPSRSPPPPPAKKNASKNSTSAPVSPAK 205 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 332 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 SP P+ S P R+ P P R PR + PPS+ P Sbjct: 145 SPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPP 184 >At3g25500.1 68416.m03171 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 1051 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +2 Query: 359 PFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSP 490 P +P P PPS LP S+ PPS P + Y SP Sbjct: 32 PIDSPPPSPPSPPPLPKLPFSSTTPPSSSDPNASPFFPLYPSSP 75 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 332 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 SP N ++T P+P PPS P+ S+P P S P Sbjct: 18 SPPSNTNSTTSSPPAPSPPSPTPPQGDSSSSPPPDSTSPP 57 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 436 P SPI + P +P P PP + P P +P PP Sbjct: 503 PPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPP 539 Score = 29.9 bits (64), Expect = 1.8 Identities = 33/118 (27%), Positives = 40/118 (33%), Gaps = 7/118 (5%) Frame = +2 Query: 317 PLAPR-SPIPN----ASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYL 481 P P+ SP PN S FR P PP P P +P PP + P Y Sbjct: 469 PQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPP--VYS 526 Query: 482 LSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLR--HHPNPAMRAPP 649 P + S P P+ P V P P S H P P + +PP Sbjct: 527 PPPPPPVYSPPPPPPVHSPP---PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 581 Score = 29.1 bits (62), Expect = 3.2 Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 1/113 (0%) Frame = +2 Query: 344 NASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDE 523 ++ ATP ++PSP+P P+ +P P + Q ++R SP + + Sbjct: 389 SSQATPSKSPSPVPTRPVHKPQPPKESPQPNDPYN-QSPVKFRR---SPPPPQ--QPHHH 442 Query: 524 SIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAP-PNHDYRDTLMK 679 + S P ++P P V P P H P P +P PN Y + +K Sbjct: 443 VVHSPPPASSPPTSP--PVHSTPSPV-----HKPQPPKESPQPNDPYDQSPVK 488 Score = 28.7 bits (61), Expect = 4.2 Identities = 30/116 (25%), Positives = 38/116 (32%), Gaps = 2/116 (1%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP--SQFQPQLDGEYRTYL 481 S P SP P + P SP PP + P P +P PP S P Y Sbjct: 586 SPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYS 645 Query: 482 LSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 649 P +S P + PL+ P P S P+ + APP Sbjct: 646 PPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPP 701 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 +P P P P S P SP PP + P P +P PPS P Sbjct: 581 SPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPP 626 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +2 Query: 305 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDG 463 G+ + A S I + + P PLPP G +L S P+PP P G Sbjct: 158 GASSSSAALSSITESEDSVLVNPPPLPPLPDGDNALSASLPLPPLPPLPPTTG 210 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPES-----LPRSTPVPPS 439 P AP +PI + S+ P P P PP+ P+S + S P PP+ Sbjct: 714 PPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPA 759 Score = 27.9 bits (59), Expect = 7.3 Identities = 25/106 (23%), Positives = 40/106 (37%), Gaps = 6/106 (5%) Frame = +2 Query: 137 PGTPAGRDLVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGT 316 P T + + + D+ + + + EDA L +KLV + + S + Sbjct: 446 PPTDSVKKFIAEDVHSVLQINNQEQNASEDATKLLHQESPSLKLVHHSATVKPLVDDSKS 505 Query: 317 PLA-----PRSPIPN-ASATPFRTPSPLPPSWRGPESLPRSTPVPP 436 P P+SP + A F P+P PP P+ P PP Sbjct: 506 PENAEENFPKSPSAHDGKAISFSPPTPSPPHPVRPQLAQAGAPPPP 551 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +2 Query: 326 PRSPIPNASATPFRT-PSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT 475 P +P P + TP + P+P P P+ P P P + + + + Y T Sbjct: 94 PPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAPGGEVEDETEFSYET 144 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 323 APRSPIPNASATPFRTPSPLP-PSWRGPESLPRSTPVPP 436 AP+ P P + P P P P P+ P+ P+ P PP Sbjct: 25 APKPPKPKPAPAP-TPPKPKPTPAPTPPKPKPKPAPTPP 62 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 454 TP P+ P TP+P PP + P P TP P + P+ Sbjct: 82 TPPKPKPKPAPTPPNPKPTPAPTPPKPK-PAPAPAPTPAPKPKPAPK 127 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 29.9 bits (64), Expect = 1.8 Identities = 28/113 (24%), Positives = 45/113 (39%), Gaps = 3/113 (2%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRT 505 P + N+ P+ +PSP P S+P PP + P + Y++ P Sbjct: 224 PPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKS---PPPPPYY 280 Query: 506 DETIDESIQSQPYRTTPLVL---PGAKVRREPGPTESYLRHHPNPAMRAPPNH 655 +++ S +S P PL + P P P SY + P P + PN+ Sbjct: 281 SPSLEVSYKSPP----PLFVYNFPPPPPFYSPSPKVSY-KSPPAPYVSKTPNY 328 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 PL P P P+ P P P P + P P S P PP P Sbjct: 1074 PLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPP 1118 Score = 27.9 bits (59), Expect = 7.3 Identities = 24/64 (37%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = +2 Query: 269 VIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWR-GPESLPRSTPVPPSQF 445 V ++ E L PL SP P P PSP PPS P SLP P PP+ Sbjct: 1047 VAEKSTEFNPLPEDSPPLPQESPPP----LPPLPPSPPPPSPPLPPSSLP---PPPPAAL 1099 Query: 446 QPQL 457 P L Sbjct: 1100 FPPL 1103 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = +2 Query: 359 PFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSS 496 PF+ P PPS P LP S PPSQ Q + T L P S Sbjct: 16 PFKKPKNRPPSPPPPLPLPPSPSPPPSQ-QMSSSRQKNTPFLFPRS 60 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 29.9 bits (64), Expect = 1.8 Identities = 32/112 (28%), Positives = 48/112 (42%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 493 TP+ SP+P TP + PSP+P + S +TPV + P + Sbjct: 445 TPVQKPSPVPT---TPVQKPSPVPTTPVHEPSPVLATPV--DKPSPVPSRPVQKPQPPKE 499 Query: 494 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 649 S + D+ D+S ++ R +P P A V P P Y P P + +PP Sbjct: 500 SPQPDDPYDQSPVTK--RRSP---PPAPVNSPPPPV--YSPPPPPPPVHSPP 544 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +2 Query: 329 RSPIP---NASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 RSP P N+ P +P P PP P P +P PP + P Sbjct: 516 RSPPPAPVNSPPPPVYSPPPPPPPVHSPPP-PVHSPPPPPVYSP 558 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 29.9 bits (64), Expect = 1.8 Identities = 35/106 (33%), Positives = 44/106 (41%), Gaps = 8/106 (7%) Frame = +2 Query: 305 GSGTPL---APRSPIPNASATPFRTPSPLPPS---WRGPES-LPRSTPVPPSQFQPQLDG 463 G +PL P SP+P P +P+P P S GP+S LP P P S P D Sbjct: 185 GPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDS 244 Query: 464 EYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGA-KVRREPGP 598 + PS + T D + S P +PL PG PGP Sbjct: 245 PLPSPGPPPSPSPTPGP-DSPLPS-PGPDSPLPSPGPDPPLPSPGP 288 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 436 TP P P P TP P P+ P P TP PP Sbjct: 134 TPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP 174 >At4g11260.1 68417.m01822 phosphatase-related low similarity to protein phosphatase T [Saccharomyces cerevisiae] GI:897806; contains Pfam profiles PF00515: TPR Domain, PF05002: SGS domain, PF04969: CS domain Length = 358 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +2 Query: 161 LVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVE-REGLRGSGTPLAPRSP 337 L +G K+++Y E ++ N P K++ + D+ E + P+ P Sbjct: 74 LRKGTACMKLEEYSTAKAALEKGASVAPNEPKFKKMIDECDLRIAEEEKDLVQPMPPS-- 131 Query: 338 IPNASATPFRTPSPLPP 388 +P++S TP T + PP Sbjct: 132 LPSSSTTPLATEADAPP 148 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPP-SWRGPESLPRSTPVPPSQFQPQL 457 P P P S P+ P P PP + P S P P PP QP + Sbjct: 411 PSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYM 455 >At3g10070.1 68416.m01207 transcription initiation factor IID (TFIID) subunit A family protein similar to hypothetical protein GB:CAB10099 [Schizosaccharomyces pombe]; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 539 Score = 29.9 bits (64), Expect = 1.8 Identities = 23/92 (25%), Positives = 35/92 (38%), Gaps = 4/92 (4%) Frame = +2 Query: 386 PSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVL 565 P S P TP PS +P + + +PS+ + ++ SI S P +P + Sbjct: 4 PRQSSTASQPPETPPQPSDSKPSTLTQIQP---TPSTNPSPSSVVSSIPSSPAPQSPSLN 60 Query: 566 PGAK----VRREPGPTESYLRHHPNPAMRAPP 649 P R P +H P +R PP Sbjct: 61 PNPNPPQYTRPVTSPATQQQQHLSQPLVRPPP 92 >At5g55020.1 68418.m06853 myb family transcription factor (MYB120) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 523 Score = 29.5 bits (63), Expect = 2.4 Identities = 32/117 (27%), Positives = 45/117 (38%), Gaps = 14/117 (11%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESL------PRSTP------VPPSQFQPQLDGEY 469 PRS I N + F P P PP + P SL +TP V + F P Y Sbjct: 260 PRSQINNNNNGNFTFPRP-PPLLQPPSSLFAKRYNNANTPLNCINRVSTAPFSPVSRDSY 318 Query: 470 RTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTE--SYLRHHPNPA 634 ++L P + T +T + PY ++P P T S+L H P+ Sbjct: 319 TSFLTLPYPSPTAQTATYHNTNNPYSSSPSFSLNPSSSSYPTSTSSPSFLHSHYTPS 375 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 29.5 bits (63), Expect = 2.4 Identities = 35/129 (27%), Positives = 49/129 (37%), Gaps = 12/129 (9%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT----YL 481 T +A P AS P + SPLP LP PP + P + EY++ Y+ Sbjct: 18 TMVAAYEPETYASPPPLYS-SPLPEVEYKTPPLPYVDSSPPPTYTPAPEVEYKSPPPPYV 76 Query: 482 LS---PSSTRTDETIDESIQSQPY----RTTPLVLPGAKVRREPGPTESYLRHHPNPAMR 640 S P + +D PY P P KV + P Y+ + P P Sbjct: 77 YSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK-SPPPPYVYNSPPPPYY 135 Query: 641 AP-PNHDYR 664 +P P DY+ Sbjct: 136 SPSPKVDYK 144 >At3g46620.1 68416.m05061 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 395 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 631 WVGVMTQVTLCGARLPSDLSSREHERSGAVRLTLNRL 521 W+ + +C LPSD R +E AV +T+ RL Sbjct: 245 WLSIRNSCPVCRFELPSDPIQRSNEEEHAVGMTIWRL 281 >At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein (FLA8) Length = 420 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP 427 P+ +P P + +P P PP+ PES P +P Sbjct: 346 PVTAPTPSPADAPSPTAASPPAPPTDESPESAPSDSP 382 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +2 Query: 329 RSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 454 +SP P + P P+P P P S P PP+ P+ Sbjct: 336 KSPSPAPAPEPVTAPTPSPAD--APSPTAASPPAPPTDESPE 375 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 29.5 bits (63), Expect = 2.4 Identities = 20/74 (27%), Positives = 28/74 (37%) Frame = +2 Query: 212 LRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPS 391 +R EDA+ + + P+ GS P P P+ + P TP+P PS Sbjct: 28 VRFEDAKTYYLSPPSGSHGTPPSHTPPSSNCGS-PPYDPSPSTPSHPSPPSHTPTPSTPS 86 Query: 392 WRGPESLPRSTPVP 433 P TP P Sbjct: 87 HTPTPHTPSHTPTP 100 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 29.5 bits (63), Expect = 2.4 Identities = 20/74 (27%), Positives = 28/74 (37%) Frame = +2 Query: 212 LRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPS 391 +R EDA+ + + P+ GS P P P+ + P TP+P PS Sbjct: 28 VRFEDAKTYYLSPPSGSHGTPPSHTPPSSNCGS-PPYDPSPSTPSHPSPPSHTPTPSTPS 86 Query: 392 WRGPESLPRSTPVP 433 P TP P Sbjct: 87 HTPTPHTPSHTPTP 100 >At2g27100.1 68415.m03256 C2H2 zinc-finger protein SERRATE (SE) identical to C2H2 zinc-finger protein SERRATE GI:14486602 from [Arabidopsis thaliana] Length = 720 Score = 29.5 bits (63), Expect = 2.4 Identities = 37/111 (33%), Positives = 45/111 (40%), Gaps = 16/111 (14%) Frame = +2 Query: 380 LPPSWRGPESLP-RST-----PVPPSQFQPQLDGEYRTYLLS-----PSSTRTDET-IDE 523 LPPS LP +ST P PPS PQ + E L S R DE I+ Sbjct: 6 LPPSDSVDNRLPEKSTSSSPPPPPPSSSLPQQEQEQDQQQLPLRRERDSRERRDERDIER 65 Query: 524 SIQSQPYRT-TPLVLPGAKVRREPG--PTESYL-RHHPNPAMRAPPNHDYR 664 ++ R +PL P +R P P Y R H P R+PP YR Sbjct: 66 PPPNRRERDRSPLPPPRRDYKRRPSLSPPPPYRDRRHSPPQRRSPPQKRYR 116 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 29.5 bits (63), Expect = 2.4 Identities = 28/107 (26%), Positives = 43/107 (40%), Gaps = 1/107 (0%) Frame = +2 Query: 335 PIPNASATP-FRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDE 511 P P+ +P R P PPS + + R+TP PPS ++ +R PSS Sbjct: 426 PPPSFKMSPTVRVLPPPPPSSKMSPTF-RATPPPPSS---KMSPSFRATPPPPSS----- 476 Query: 512 TIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPN 652 + S ++ P + + P K P P Y P P+ P+ Sbjct: 477 KMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPS 523 Score = 28.7 bits (61), Expect = 4.2 Identities = 26/117 (22%), Positives = 40/117 (34%), Gaps = 12/117 (10%) Frame = +2 Query: 335 PIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDG--------EYRTYLLSP 490 P P++ +P +P PPS + S + P P S+ P + EY P Sbjct: 457 PPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPP 516 Query: 491 SSTRTDET----IDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 649 SS + + P P + + P P Y+ P P + PP Sbjct: 517 SSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPP 573 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 433 P P SP P + P+ SP PPS P S+P P Sbjct: 529 PPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/50 (34%), Positives = 20/50 (40%) Frame = +2 Query: 296 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQF 445 G R PL P ++ P T P G S P STP PP Q+ Sbjct: 239 GGRSPPLPLPPGQFTAGNASFPSSTQPPPGQYMAGNASFPSSTPPPPGQY 288 Score = 27.9 bits (59), Expect = 7.3 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSW--RGPESLPRSTPVPPSQF 445 P SP S P PLPP G S P ST PP Q+ Sbjct: 229 PSSPSQIHSGGGRSPPLPLPPGQFTAGNASFPSSTQPPPGQY 270 Score = 27.9 bits (59), Expect = 7.3 Identities = 25/92 (27%), Positives = 35/92 (38%), Gaps = 4/92 (4%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLS 487 S T P + ++ P TP P G STP+PP Q+ P ++ + T S Sbjct: 261 SSTQPPPGQYMAGNASFPSSTPPPPGQYMAGNAPFSSSTPLPPGQY-PAVNAQLSTSAPS 319 Query: 488 ---PSSTRTDETIDESIQSQPYRTTP-LVLPG 571 P T S +QP P +PG Sbjct: 320 VPLPPGQYTAVNAPFSTSTQPVSLPPGQYMPG 351 >At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family protein Length = 523 Score = 29.5 bits (63), Expect = 2.4 Identities = 19/72 (26%), Positives = 25/72 (34%) Frame = +2 Query: 251 PNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV 430 P+ I + + G G PL +PI R P P P R R+ V Sbjct: 200 PDNIFNALGNEFSHPSGAGRGKPLVESAPIRQEDNRQIRRPPPPPQQQRVQPQQKRAPTV 259 Query: 431 PPSQFQPQLDGE 466 +PQL E Sbjct: 260 KDGTPKPQLSAE 271 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 359 PFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT 475 P+ +PSP P P S+P PP + P EY++ Sbjct: 721 PYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKS 759 Score = 27.9 bits (59), Expect = 7.3 Identities = 30/112 (26%), Positives = 39/112 (34%) Frame = +2 Query: 314 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPS 493 TP SP P P+ +PSP P P S+P PP + P Y+ SP Sbjct: 560 TPYVYHSPPP----PPYYSPSPKPAYKSSPPPYVYSSP-PPPYYSPAPKPVYK----SPP 610 Query: 494 STRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 649 + S + T P V P P Y P P ++PP Sbjct: 611 PPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPP--PYYSPTPKPTYKSPP 660 Score = 27.5 bits (58), Expect = 9.7 Identities = 27/108 (25%), Positives = 38/108 (35%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRT 505 P + N+ P+ +PSP P P S+P PP + P Y+ SP Sbjct: 610 PPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSP-PPPYYSPTPKPTYK----SPPPPYV 664 Query: 506 DETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPP 649 + S + T P V P P Y P P ++PP Sbjct: 665 YSSPPPPYYSPSPKPTYKSPPPPYVYSSPPP--PYYSPAPKPTYKSPP 710 >At1g08060.2 68414.m00881 MOM1 identical to MOM1 (mutation in a 'Morpheus molecule') [Arabidopsis thaliana] gi|8132770|gb|AAF73381.1| Length = 2001 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 320 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 454 +AP + A+ R+P+P S+R S P +T P S PQ Sbjct: 1919 IAPTPSVTPATNPGLRSPAPHLNSYRPSSSTPVATATPTSSVPPQ 1963 >At1g08060.1 68414.m00880 MOM1 identical to MOM1 (mutation in a 'Morpheus molecule') [Arabidopsis thaliana] gi|8132770|gb|AAF73381.1| Length = 2001 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 320 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 454 +AP + A+ R+P+P S+R S P +T P S PQ Sbjct: 1919 IAPTPSVTPATNPGLRSPAPHLNSYRPSSSTPVATATPTSSVPPQ 1963 >At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family protein Common family member: At2g32840 [Arabidopsis thaliana] Length = 332 Score = 29.5 bits (63), Expect = 2.4 Identities = 36/143 (25%), Positives = 55/143 (38%), Gaps = 3/143 (2%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLS 487 S TP+ P + + + P P PLPP P P + P+ FQ Q Y L + Sbjct: 22 SETPVTPVNTVRPPPSQPPPAPPPLPP----PTYRPIAPLRHPNPFQQQ--SAYSNNLYA 75 Query: 488 PSSTRTDETIDESIQSQPYRTTPLVLPGAKVR---REPGPTESYLRHHPNPAMRAPPNHD 658 S + D S P+ VR +P T L +P P+ Sbjct: 76 HSIPVRRQIQDPSAVLYPFALPGRGFSARPVRGFVADPSVTAGNLSGYP-----PRPSFT 130 Query: 659 YRDTLMKQKVAESVLQRVVGEKH 727 Y +Q+ ES+LQ+ + E++ Sbjct: 131 YDPGPYEQRQMESLLQQFIRERN 153 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 371 PSPLPPSWRG-PESLPRSTPVPPSQFQPQLDGEY 469 P PL P +G P S+P S P P Q Q Q Y Sbjct: 109 PPPLSPDGKGSPPSVPSSPPSPKGQSQGQQQPPY 142 >At3g32904.1 68416.m04164 hypothetical protein Length = 330 Score = 29.1 bits (62), Expect = 3.2 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = +2 Query: 296 GLRGSGTPLAPRSPIPNA-SATPFRTPSPLPPSWRGPESLPR--STPVPPSQFQP 451 G + GTP P +P N+ S P T P P W P S+P+ S+P P P Sbjct: 273 GFQQWGTP--PTAPQWNSPSNVPQWTIPPTTPQWGTPSSMPQWSSSPTAPQLSSP 325 >At3g07130.1 68416.m00849 serine/threonine protein phosphatase family protein contains similarity to purple acid phosphatase [Arabidopsis thaliana] gi|20257489|gb|AAM15914 Length = 532 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 212 GHVRHNRRSSR*YPHGLSPCRPEYL 138 GHV RS+R Y + L PC P Y+ Sbjct: 395 GHVHAYERSNRVYNYELDPCGPVYI 419 >At3g02670.1 68416.m00258 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 217 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +2 Query: 338 IPNASATP-FRTPSPLPPSWRGPESLPRS-TPVPP 436 IP +P FR P P PPS G LP P+PP Sbjct: 146 IPGIPGSPGFRLPFPFPPSGGGIPGLPLPFPPLPP 180 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 29.1 bits (62), Expect = 3.2 Identities = 27/115 (23%), Positives = 37/115 (32%), Gaps = 3/115 (2%) Frame = +2 Query: 326 PRSPIP-NASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTR 502 P P P + TP +P PP P + S P+ P +P P Sbjct: 435 PVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKP 494 Query: 503 TDETIDESIQSQPYR--TTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDY 661 T ++ P + TP P K PT +Y P + PP Y Sbjct: 495 PTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTY 549 Score = 28.7 bits (61), Expect = 4.2 Identities = 30/115 (26%), Positives = 37/115 (32%), Gaps = 3/115 (2%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV-PPSQFQPQLDGEYRTYLLSPSSTR 502 P P P TP +P PP P + S PV PP +P P Sbjct: 335 PIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKP 394 Query: 503 TDETIDESIQSQPYR--TTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDY 661 T I+ P + TP P K+ PT Y P + PP Y Sbjct: 395 PTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIY 449 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 433 PL +P P + P P+P P P P TP P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAP 329 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/50 (28%), Positives = 19/50 (38%) Frame = +2 Query: 284 VEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 433 ++ G + P +P P + P PSP P S P P P P Sbjct: 282 IDALGAHFAPLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAP 331 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 433 PL +P P + P P+P P P P TP P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAP 329 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/50 (28%), Positives = 19/50 (38%) Frame = +2 Query: 284 VEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 433 ++ G + P +P P + P PSP P S P P P P Sbjct: 282 IDALGAHFAPLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAP 331 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +2 Query: 251 PNQIKLVIQRDVEREGLRGSGTP-LAPRSPIPNASATPFRTPSPLPPSWRG 400 P + + +++ V L GT L P P+P A+ P P PP RG Sbjct: 235 PPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGARG 285 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 482 LSPSSTRTDETIDESIQSQPYRTTPLVLPGAKV 580 +SP ST+T ES+ QP R ++ P +KV Sbjct: 62 VSPRSTKTSNDRSESLAKQPIRPKTVLSPPSKV 94 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 29.1 bits (62), Expect = 3.2 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 454 S P P PN P TP P PPS S P S PPS QPQ Sbjct: 59 SPPPATAAQPPPNQP--PNTTPPPTPPS-----SPPPSITPPPSPPQPQ 100 Score = 27.5 bits (58), Expect = 9.7 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLD 460 P P PN + P PS PPS P S P+ P PP Q P D Sbjct: 70 PNQP-PNTTPPP-TPPSSPPPSITPPPSPPQ--PQPPPQSTPTGD 110 >At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; similar to root nodule extensin [Pisum sativum] gi|15021750|gb|AAK77902; Common family members: At5g19800, At5g57070, At1g72790 [Arabidopsis thaliana] Length = 102 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 5/38 (13%) Frame = +2 Query: 335 PIPNASATPFRTPSPLP-----PSWRGPESLPRSTPVP 433 P+ + S +P+R+P LP P++ P +LP + P+P Sbjct: 38 PLYSPSPSPYRSPVTLPPPPPHPAYSRPVALPPTLPIP 75 >At4g01810.1 68417.m00238 protein transport protein-related related to Sec23 protein [Homo sapiens] gi|1296664|emb|CAA65774 Length = 880 Score = 28.7 bits (61), Expect = 4.2 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 5/56 (8%) Frame = +2 Query: 305 GSGTPLAPRSPIPNASATPF-RTP----SPLPPSWRGPESLPRSTPVPPSQFQPQL 457 G+ TPL P P P TP +P SP+PP + P P PS P L Sbjct: 13 GTLTPLEPNRPSPQPDRTPVPHSPPVVASPIPPRFPQPSFRPDQMS-SPSMKSPSL 67 >At3g57380.1 68416.m06387 expressed protein contains Pfam domain, PF04577: Protein of unknown function (DUF563) Length = 504 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/60 (28%), Positives = 30/60 (50%) Frame = +2 Query: 170 GDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNA 349 GDI++++ DY D + + FK A +K+ + VE + G+ T L R+ + A Sbjct: 235 GDIVSQLSDYPPVDFNGDKRTHCFKEAIVGLKIHDELTVESSLMLGNKTILDFRNVLDQA 294 >At3g24860.1 68416.m03118 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 310 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 538 AVPHHSSRAPGS*GPKGAW--PHRELPASSPQPSNEGTS*P 654 A P +S P P A PH++ P S PQP+N + P Sbjct: 2 ATPSPTSSPPSDSNPNSAATPPHQKQPPSPPQPTNPSSPPP 42 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 436 P P P+P P +P P PP + P S P +P PP Sbjct: 413 PPPPSPPLP----PPVYSPPPSPPVFSPPPSPPVYSPPPP 448 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQF 445 P P P++ P+ P PLP P P S P PP + Sbjct: 41 PVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPPPAY 80 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +2 Query: 317 PLAPRSPIPNASATPF-RTP--SPLPPSWRGPESLPRSTPVPPSQFQPQL 457 P P P P P + P SP PP+ P +P +P PP+ P L Sbjct: 160 PQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLPPPL 209 >At1g75340.1 68414.m08751 zinc finger (CCCH-type) family protein weak similarity to Nucleoporin NUP42 (Nuclear pore protein NUP42) (Swiss-Prot:P49686) [Saccharomyces cerevisiae]; contains Pfam profile PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 435 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/52 (36%), Positives = 24/52 (46%) Frame = +2 Query: 296 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 GL SG P A S +A TP P+P G ++ P ST P+ F P Sbjct: 295 GLSSSGPPNAFASFNKQPNAFSVNTPQPVPSGPSGFQTNP-STTFKPASFGP 345 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 28.7 bits (61), Expect = 4.2 Identities = 18/51 (35%), Positives = 22/51 (43%) Frame = +2 Query: 299 LRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 L+GS P P P+P A P P P PP R + P P P + P Sbjct: 503 LKGSAPPPPPPPPLPTTIAAP--PPPPPPP--RAAVAPPPPPPPPGTAAAP 549 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +2 Query: 296 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 436 G GSG P P P+P A+ TP P PP P PP Sbjct: 583 GNSGSGGPPPPPPPMPLANGA---TPPPPPPPMAMANGAAGPPPPPP 626 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 436 +G P P SP P S P SP PPS PE P S+ PP Sbjct: 143 AGQPPPPESP-PPESLPPPSPESPSPPS---PEPPPPSSLEPP 181 Score = 27.9 bits (59), Expect = 7.3 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = +2 Query: 290 REGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 R +GT P P S P P P P S S P P PPS +P Sbjct: 131 RRTTAAAGTTTIAGQPPPPESPPPESLPPPSPES----PSPPSPEPPPPSSLEP 180 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +2 Query: 323 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 454 +P P+P S+ + SP PPS +S +P PPS PQ Sbjct: 62 SPPPPLPENSSDGSSSSSPPPPSDSSSQS---QSPPPPSTSPPQ 102 >At1g49190.1 68414.m05515 two-component responsive regulator family protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain ;contains similarity to two-component response regulator protein (ARR2) GI:4210451 from [Arabidopsis thaliana] Length = 608 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/71 (23%), Positives = 24/71 (33%) Frame = +2 Query: 449 PQLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPN 628 P L G PS IQ Y+ L + ++ P P YL HH Sbjct: 498 PSLQGSDNVNTTIPSYLMNGPATLNQIQQNQYQNGFLTMNNNQIITNPPPPLPYLDHHHQ 557 Query: 629 PAMRAPPNHDY 661 ++ P +Y Sbjct: 558 QQHQSSPQFNY 568 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWR--GPESLPRS--TPVPPSQFQP 451 P P+ P +P+P PP W P +P+ P PP F P Sbjct: 30 PHPPVEVEENQPKTSPTPPPPHWMRYPPVLMPQMMYAPPPPMPFSP 75 >At5g58040.1 68418.m07263 fip1 motif-containing protein contains Pfam profile PF05182: Fip1 motif Length = 1192 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/68 (26%), Positives = 27/68 (39%) Frame = +2 Query: 521 ESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDTLMKQKVAESV 700 ES+ Q + V+ G+K + S + H PN A R N D + K + Sbjct: 994 ESLSKQGEQNGSSVVTGSKGTNDARNCRSEIPHQPNTAKRHKENASSGDEIHDSKRGRTK 1053 Query: 701 LQRVVGEK 724 L+R K Sbjct: 1054 LERWASHK 1061 >At5g56980.1 68418.m07112 expressed protein non-consensus CG donor splice site at exon 1, GA donor splice site at exon 3 Length = 379 Score = 28.3 bits (60), Expect = 5.6 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 4/96 (4%) Frame = +2 Query: 371 PSPLP-PSWRGPESLPRSTPVPPSQFQ-PQLDGEYRTYLLSPSSTRTDETIDESIQSQPY 544 P P P P R P L R + S F+ Q + E Y + T+ T ESI ++ Sbjct: 149 PDPAPAPLQRAPSLLDRVKSINMSYFKFQQYNPEENDY-----AHHTEPTRFESIPTRMG 203 Query: 545 RTTPLVLPGAKVRREPGPTESYLRHHPNP--AMRAP 646 R P+ + ++ E PT + + NP RAP Sbjct: 204 RVDPIDISKFRIPEEDQPTGTGVNSQINPPGLTRAP 239 >At5g56890.1 68418.m07099 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 1113 Score = 28.3 bits (60), Expect = 5.6 Identities = 27/105 (25%), Positives = 39/105 (37%), Gaps = 4/105 (3%) Frame = +2 Query: 371 PSPLPPSWRGP-ESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTD---ETIDESIQSQ 538 PSPLPP P +S + + PP Q L+SP+ + I ++ Sbjct: 362 PSPLPPHLISPKKSNRKGSMTPPPQSHHAPSPPIPDSLISPAHAPVSFSMKRISPALAPS 421 Query: 539 PYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDYRDTL 673 P + PL + P L+ P P PPN D T+ Sbjct: 422 PTQVFPLRSSSRPSKSRKFPLGPPLQAFPPP----PPNSDCSSTI 462 >At5g21160.1 68418.m02528 La domain-containing protein / proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965, PF05383: La domain Length = 826 Score = 28.3 bits (60), Expect = 5.6 Identities = 26/97 (26%), Positives = 36/97 (37%) Frame = +2 Query: 371 PSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDESIQSQPYRT 550 P+P PPS P S+P TP Q + + G+ +PS R + S Q+ P Sbjct: 66 PAPAPPSKNIPTSIPIPTPAVTGQAKSKGGGKANPGHKNPSG-RHSKPGPRSNQNGP-PP 123 Query: 551 TPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPNHDY 661 P ++ P P L H P P Y Sbjct: 124 PPYLVHAVPYHPPPFPPMVPLPHAAGPDFPYAPYPPY 160 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 28.3 bits (60), Expect = 5.6 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 8/110 (7%) Frame = +2 Query: 323 APRSPIPNASATPFRTP-----SPLP-PSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLL 484 +P+SP P + ++P TP P+P P P S P P P + P + Sbjct: 69 SPKSPAPVSESSPPPTPVPESSPPVPAPMVSSPVSSP-PVPAPVADSPPAPVAAPVADVP 127 Query: 485 SPSSTRTDETIDES--IQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPN 628 +P+ ++ +T +S Q+ P L+ P A PGP P+ Sbjct: 128 APAPSKHKKTTKKSKKHQAAPAPAPELLGPPAPPTESPGPNSDAFSPGPS 177 >At3g16770.1 68416.m02141 AP2 domain-containing protein RAP2.3 (RAP2.3) identical to GI:2281631 [Arabidopsis thaliana]; identical to cDNA EBP GI:2190330 Length = 248 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 377 PLPPSWRGPESLPRSTPVPPSQ 442 P PP++ P S PRST PP++ Sbjct: 140 PPPPNYTPPPSSPRSTDQPPAK 161 >At2g41870.1 68415.m05177 remorin family protein contains Pfam domain, PF03763: Remorin, C-terminal region Length = 274 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = +2 Query: 332 SPIPNASATPFRTPSPLPPSWRGPESLPRS-TPVPPSQFQPQLDGEYRTYLLSPSSTRTD 508 +P P ++ P PP++RG S PRS T + + + E+ +++ SS + Sbjct: 33 TPAPEDNSRTMTATLPPPPAFRGYFSPPRSATTMSEGENFTTISREFNALVIAGSSMENN 92 Query: 509 ETIDESI 529 E + + Sbjct: 93 ELMTRDV 99 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 28.3 bits (60), Expect = 5.6 Identities = 20/76 (26%), Positives = 27/76 (35%) Frame = +2 Query: 320 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSST 499 L S +P SA P P PP +P P F+P + S Sbjct: 23 LQDASSLPGFSAIPPVVPPSFPPPMAPIPMMPHPPVARPPTFRPPVSQNGGVKTSDSDSE 82 Query: 500 RTDETIDESIQSQPYR 547 DE I+ S +S+ R Sbjct: 83 SDDEHIEISEESKQVR 98 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/51 (35%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPS-----PLPPSWRGPESLPRSTPVPPSQFQPQ 454 P P+ P N+ A P PS P PP P S P P PP + Q Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQ 59 Score = 27.5 bits (58), Expect = 9.7 Identities = 32/136 (23%), Positives = 46/136 (33%), Gaps = 3/136 (2%) Frame = +2 Query: 326 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRT 505 P P+P + P P PPS P P + P S P + Y P + Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQF 66 Query: 506 DETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAPPN---HDYRDTLM 676 ++ P PLV P + P E RA P+ H +R L Sbjct: 67 NQLQAPPPPPPPSAPPPLV-PDPPRHQGPNDHEKGASKQVGRRERAKPDPSKHHHRSHLP 125 Query: 677 KQKVAESVLQRVVGEK 724 K E+ +R + +K Sbjct: 126 HSKKIETEEERRLRKK 141 >At1g78310.1 68414.m09126 VQ motif-containing protein contains PF05678: VQ motif Length = 311 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 341 PNASATPFRTPSPLPPSWRGPESLPRSTPVPP 436 P + F P P PPS +++P S P PP Sbjct: 233 PPSQHNSFPPPHPPPPSSAVSQTVPTSIPAPP 264 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 28.3 bits (60), Expect = 5.6 Identities = 36/129 (27%), Positives = 42/129 (32%), Gaps = 16/129 (12%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP------------PSQFQP 451 S P P P S P + P PP P P TP P P F P Sbjct: 46 SPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPP 105 Query: 452 QLDGEYRTYLLSPSSTRTDE----TIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRH 619 +D SP E DE +S P P LP + GP + +H Sbjct: 106 PIDSPPPESTNSPPPPEVFEPPPPPADED-ESPPAPPPPEQLPPPASSPQGGPKKP-KKH 163 Query: 620 HPNPAMRAP 646 HP PA P Sbjct: 164 HPGPATSPP 172 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +2 Query: 320 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP-SQFQPQLDG 463 + P S P P P P PP ++LPR P PP S +P+ DG Sbjct: 85 IKPLSSPPPPQPPPRSQPPPKPPQ----KNLPRRHPPPPRSPEKPKRDG 129 >At1g03780.1 68414.m00359 targeting protein-related similar to microtubule-associated protein / targeting protein for Xklp2 ((TPX2) GI:8926138) {Homo sapiens}; similar to Restricted expression proliferation associated protein 100 (p100) (Differentially expressed in lung cells 2) (DIL-2) (Targeting protein for Xklp2) (C20orf1 protein) (C20orf2 protein) (Protein FLS353)(SP:Q9ULW0) {Homo sapiens} Length = 687 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/70 (20%), Positives = 32/70 (45%) Frame = +1 Query: 271 HTKGRGTRRTERFRHATSATFAHTQRKRHTIQDSKPVASVMAWSGISASQHTGATFAIPA 450 H + R R + F H S F+H ++++ S+ S++ W+ I ++ + + Sbjct: 617 HVEHRAVERAD-FDHKVSILFSHFSKQKNASITSEIDESILFWNQIKEKENQYKRYREES 675 Query: 451 TTGRRIQNLS 480 + + N+S Sbjct: 676 EAAKMVCNIS 685 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPP--SWRGPESLPRSTPVPPSQF 445 P P P P+ + +P PSP PP S P LP P PP + Sbjct: 50 PPPPSPPPPSCTPSP-PPPSPPPPKKSSCPPSPLPPPPPPPPPNY 93 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +2 Query: 320 LAPRSPIPNASATPFRTPSPLPPSWRGPE--SLPRSTPVPP 436 L + P P + P TPSP PPS P+ S P S P+PP Sbjct: 45 LQNQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPS-PLPP 84 >At4g36080.1 68417.m05136 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF00454: Phosphatidylinositol 3- and 4-kinase, PF02259: FAT domain, PF02260: FATC domain Length = 3839 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 164 VRGDIIAKIDDYDARDLRHEDAQNLFKNAP 253 ++GD K++D + +L + +A LFKN P Sbjct: 3057 LKGDFHLKLNDTEGANLAYSNAITLFKNLP 3086 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 27.9 bits (59), Expect = 7.3 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 7/56 (12%) Frame = +2 Query: 293 EGLRGSGTPLAPRSPIPNASAT-------PFRTPSPLPPSWRGPESLPRSTPVPPS 439 EG +P +P P P++S P + SP PP+ P+ +P PPS Sbjct: 3 EGQSPENSPPSPTPPSPSSSDNQQQSSPPPSDSSSPSPPAPPPPDDSSNGSPQPPS 58 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 27.9 bits (59), Expect = 7.3 Identities = 36/120 (30%), Positives = 54/120 (45%), Gaps = 9/120 (7%) Frame = +2 Query: 314 TPLAPRS-PIPNASATPFRTP---SPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYL 481 +PL+P S P ++ +P +P SPLPPS PE +P+ PS P++D Sbjct: 43 SPLSPSSSPEEDSPLSPSSSPEEDSPLPPS-SSPE---EDSPLAPSS-SPEVDSP----- 92 Query: 482 LSPSSTRTDETIDESIQSQPYRTTPL---VLPGAKVRREP--GPTESYLRHHPNPAMRAP 646 L+PSS+ ++ + S P +PL P A + P P L P+P P Sbjct: 93 LAPSSSPEVDS-PQPPSSSPEADSPLPPSSSPEANSPQSPASSPKPESLADSPSPPPPPP 151 Score = 27.9 bits (59), Expect = 7.3 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 454 S +P A SP+P +S+ +P P S PESL S PP QP+ Sbjct: 108 SSSPEAD-SPLPPSSSPEANSPQS-PASSPKPESLADSPSPPPPPPQPE 154 Score = 27.5 bits (58), Expect = 9.7 Identities = 22/66 (33%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPE--SLPRSTPVP-PSQFQPQLDGEYRT- 475 + +P +P S S +P P PP P S P PVP PS D E T Sbjct: 125 ANSPQSPASSPKPESLADSPSPPPPPPQPESPSSPSYPEPAPVPAPSDDDSDDDPEPETE 184 Query: 476 YLLSPS 493 Y SP+ Sbjct: 185 YFPSPA 190 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 314 TPLAPRSPIPNASATPF--RTPSPLPPSWRGPESLPRSTPVPP 436 TP +P P S P+ +PSP P ++ P + S P PP Sbjct: 32 TPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPP 74 >At5g55310.1 68418.m06893 DNA topoisomerase I, putative similar to Swiss-Prot:P30181 DNA topoisomerase I [Arabidopsis thaliana] Length = 917 Score = 27.5 bits (58), Expect = 9.7 Identities = 35/142 (24%), Positives = 59/142 (41%), Gaps = 8/142 (5%) Frame = +2 Query: 191 DDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSG---TPLAP--RSPI--PNA 349 D Y+ D +D +FK N + +R S T +P RSP+ PN Sbjct: 16 DGYEDED--EDDIPLVFKRNSNTAATTNRPSPINNAMRNSAIGSTKSSPPMRSPLTSPNR 73 Query: 350 SATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT-YLLSPSSTRTDETIDES 526 SA+ S + P+ S+ RST P + + + R + +PS +++D DE Sbjct: 74 SASSSTRSSMMKPALPSSSSVQRSTLKSPLRDDRSVVAKERNGFGKAPSVSKSD---DED 130 Query: 527 IQSQPYRTTPLVLPGAKVRREP 592 + + L L +V ++P Sbjct: 131 SEDDKPLSARLKLDSKEVTKQP 152 >At5g52680.1 68418.m06540 heavy-metal-associated domain-containing protein low similarity to pneumococcal surface protein A PspA [Streptococcus pneumoniae] GI:7800654; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 238 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +2 Query: 338 IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 439 I NA T R P+P+P R P P+ P PPS Sbjct: 174 INNARKTS-RVPAPVPV--RAPAPTPKPAPAPPS 204 >At5g16100.1 68418.m01881 hypothetical protein Length = 356 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = +2 Query: 407 SLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETIDESIQSQPYRTTPL 559 +LP ST VP S P D + LLSP + + ++ + TT L Sbjct: 282 TLPSSTDVPLSLLSPNEDHDVPLSLLSPEEALDIQPVPPHVELREEPTTRL 332 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +2 Query: 326 PRSPI-PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 451 P SP+ P + P + P+ PP + P P +TPV P P Sbjct: 160 PTSPVKPPTTTPPVKPPTTTPPV-QPPTYNPPTTPVKPPTAPP 201 >At5g11510.1 68418.m01343 myb family transcription factor (MYB3R4) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 961 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = +2 Query: 356 TPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSPSSTRTDETI 517 TPFR P +W+ P + P P +F L E Y+ SP R+ E+I Sbjct: 835 TPFRRGLESPSAWKSPFYINSLLPSP--RFDTDLTIEDMGYIFSPGE-RSYESI 885 >At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase family protein similar to laccase [Pinus taeda][GI:13661201], lac110 laccase, Populus trichocarpa, EMBL:PTY13773 Length = 584 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = +2 Query: 293 EGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQF 445 +G S +P P P+PN +T R S + GP P V F Sbjct: 304 QGATSSSSPAEPLMPVPNDMSTAHRFTSNITSLVGGPHWTPVPRHVDEKMF 354 >At4g19570.1 68417.m02877 DNAJ heat shock N-terminal domain-containing protein low similarity to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 558 Score = 27.5 bits (58), Expect = 9.7 Identities = 22/86 (25%), Positives = 35/86 (40%), Gaps = 1/86 (1%) Frame = +2 Query: 200 DARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSP 379 +A DL + +Q + + V QR + + S TP S P +S P P P Sbjct: 112 EAWDLLSDKSQRSSYDQKRKSNQVKQRTSGMQKPKRSSTPKPTESDKPASSYGPTPPPEP 171 Query: 380 LPPSWRGPESLPRSTPVP-PSQFQPQ 454 P P P+P P++ +P+ Sbjct: 172 RPKRRPRPNIPEPDIPMPMPTRHKPK 197 >At4g18760.1 68417.m02772 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 431 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +2 Query: 332 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQ 448 S P+ S TP T SP+PP P S S+P+ P Q + Sbjct: 20 SAAPSLSPTPSPTTSPIPP--HKPSS--SSSPLDPKQLK 54 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = +2 Query: 317 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV-PPSQFQPQLDGEYRTYLLSPS 493 P +P P S P P+P W P S P P P + P E +++PS Sbjct: 73 PAPSFAPGPGPSFAPGPAPNPRSYDWLAPASSPNEPPAETPDESSPS-PSEETPSVVAPS 131 Query: 494 ST 499 + Sbjct: 132 QS 133 Score = 27.5 bits (58), Expect = 9.7 Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 4/66 (6%) Frame = +2 Query: 413 PRSTPVPPSQFQPQLDGEYRTY-LLSPSSTRTD---ETIDESIQSQPYRTTPLVLPGAKV 580 P P P F P R+Y L+P+S+ + ET DES S T +V P V Sbjct: 75 PSFAPGPGPSFAPGPAPNPRSYDWLAPASSPNEPPAETPDESSPSPSEETPSVVAPSQSV 134 Query: 581 RREPGP 598 P P Sbjct: 135 PGPPRP 140 >At4g14990.1 68417.m02303 expressed protein Length = 787 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = +2 Query: 485 SPSSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTESYLRHHPNPAMRAP 646 S S RT + Q Q Y + P+++P + P P + + P+ RAP Sbjct: 151 SNSLYRTSSYPQQQTQLQHYSSEPIIVPESTFTSFPSPGKRSQQSSPSHIHRAP 204 >At3g44200.1 68416.m04739 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 941 Score = 27.5 bits (58), Expect = 9.7 Identities = 20/78 (25%), Positives = 33/78 (42%), Gaps = 4/78 (5%) Frame = +2 Query: 347 ASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDG----EYRTYLLSPSSTRTDET 514 A ++ +P+PPS +S PP P +D + R +SPS E Sbjct: 420 AHSSKTNASTPIPPSKLASDSARTPGSFPPKHHMPVIDSSPKLKPRNDRISPSPAAKHEA 479 Query: 515 IDESIQSQPYRTTPLVLP 568 +E++ + + TP LP Sbjct: 480 -EEAMSVKRRQRTPPTLP 496 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 308 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 439 S P P++P+ N S +P P P PS P L P PP+ Sbjct: 55 SEPPPPPKAPV-NVSLSP--PPPPRSPSTSTPPRLGNRNPPPPA 95 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 27.5 bits (58), Expect = 9.7 Identities = 27/117 (23%), Positives = 41/117 (35%), Gaps = 4/117 (3%) Frame = +2 Query: 311 GTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLLSP 490 G+ +A ++ P+ SP PP P +P PP + P Y + P Sbjct: 23 GSAMATEPYYYSSPPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPP---PYYYHSPPP 79 Query: 491 SSTRTDETIDESIQSQPYRTTPLVLPGAKVRREPGPTES----YLRHHPNPAMRAPP 649 S P ++ P P P P +S Y H P P +++PP Sbjct: 80 PVKSPPPPYVYSSPPPPVKSPP---PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP 133 >At2g40760.1 68415.m05028 rhodanese-like domain-containing protein contains rhodanese-like domain PF00581 Length = 474 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +2 Query: 242 KNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPI---PNASATPFRTPSPLPPSW 394 + + ++ IQRDV GLR TP++P ++S++P P W Sbjct: 153 RESVEEVLAFIQRDVRLNGLRQVETPVSPEQEAIHHGHSSSSPLAAGEDAPFRW 206 >At2g17930.1 68415.m02076 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF02259 FAT domain, PF00454 Phosphatidylinositol 3- and 4-kinase, PF02260: FATC domain Length = 3795 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 164 VRGDIIAKIDDYDARDLRHEDAQNLFKNAP 253 ++GD K++D ++ ++ + +A LFKN P Sbjct: 2984 LKGDFHLKLNDTESANIAYSNAITLFKNLP 3013 >At1g63570.1 68414.m07186 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function DUF26; similar to receptor-like protein kinase 4 (GI:13506745) [Arabidopsis thaliana] Length = 284 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +2 Query: 332 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 457 SP P+ S+ P P+ P+ P SLP P P SQ P L Sbjct: 246 SPAPSPSSLP-----PISPTSSPPLSLPPQLPPPLSQPPPPL 282 >At1g14920.1 68414.m01783 gibberellin response modulator (GAI) (RGA2) / gibberellin-responsive modulator identical to GAI GB:CAA75492 GI:2569938 [Arabidopsis thaliana] (Genes Dev. In press) Length = 533 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 470 RTYLLSPSSTRTDETIDESIQSQPYRTTP 556 R Y LSPS + D ++ +++Q Y T P Sbjct: 220 RIYRLSPSQSPIDHSLSDTLQMHFYETCP 248 >At1g12970.1 68414.m01506 leucine-rich repeat family protein Length = 464 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 596 PTESYLRHHPNPAMRAPPN 652 P SY+ HH +PA APP+ Sbjct: 9 PLLSYVLHHSDPASHAPPS 27 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,241,355 Number of Sequences: 28952 Number of extensions: 436844 Number of successful extensions: 2437 Number of sequences better than 10.0: 131 Number of HSP's better than 10.0 without gapping: 1582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2159 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -