BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31465 (535 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44729| Best HMM Match : SET (HMM E-Value=0) 29 2.4 SB_13473| Best HMM Match : DUF1040 (HMM E-Value=1.5) 28 5.5 SB_49131| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) 27 9.6 SB_38437| Best HMM Match : VWA (HMM E-Value=0) 27 9.6 SB_17096| Best HMM Match : Novirhabdo_Nv (HMM E-Value=2.4) 27 9.6 SB_1015| Best HMM Match : Extensin_2 (HMM E-Value=0.11) 27 9.6 >SB_44729| Best HMM Match : SET (HMM E-Value=0) Length = 1112 Score = 29.1 bits (62), Expect = 2.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 325 HFRQRCTSSRGPFHRGRRTSTVREPQEPH 239 HF C S++ P +RGR T +R P H Sbjct: 503 HFCSTCISNKTPVNRGRLTKCIRCPTAYH 531 >SB_13473| Best HMM Match : DUF1040 (HMM E-Value=1.5) Length = 154 Score = 27.9 bits (59), Expect = 5.5 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -3 Query: 470 PIVFLVYKILTLQMIDNTLLGHF 402 P++ ++K +T Q+ DN+L+ HF Sbjct: 22 PVISFIHKCMTGQITDNSLIRHF 44 >SB_49131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1163 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 292 PFHRGRRTSTVREPQEPHFRYR 227 PF R R V+EP+EP+ +YR Sbjct: 472 PFERYRFNRRVQEPREPYDQYR 493 >SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) Length = 591 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +1 Query: 124 ILQQTFDNIGVEGYGFGFETSDGKTAQESAVLKNVGTENEALEVRGQYSYVDLD 285 +L+ T D + + G DG TAQ SA+L + +N+ +G+ +D Sbjct: 265 LLKNTLDTVFLRGQTI---VGDGTTAQLSAILTGIAEKNQPEARKGRKKATTVD 315 >SB_38437| Best HMM Match : VWA (HMM E-Value=0) Length = 3445 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = -2 Query: 387 VGVGGLDLRELGNVCSGGMETIFVSGVRRLVDLSIEVDVRVLSANL 250 V +GG R++ + S +FV G++RLV + + RV +A++ Sbjct: 2407 VSIGGGGRRQVTRIASTRSH-VFVVGIKRLVKIVGRIQARVCTASV 2451 >SB_17096| Best HMM Match : Novirhabdo_Nv (HMM E-Value=2.4) Length = 211 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 6/37 (16%) Frame = -3 Query: 362 GSWGMSAPEGW------KPFSSAVYVVSWTFPSRSTY 270 G+WG+ PEGW PF Y + PS++ + Sbjct: 40 GNWGLEIPEGWGSYLRPPPFGGDGYFLELHIPSQTKH 76 >SB_1015| Best HMM Match : Extensin_2 (HMM E-Value=0.11) Length = 828 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +1 Query: 178 ETSDGKTAQESAVLKNVGTENEALEVRGQYSYVDLDGKVHE 300 ETSDG T QE +K E++ EVR + D + E Sbjct: 449 ETSDGDTKQEVPFIKEEQIEDKGPEVRNDMEPHETDVPLQE 489 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,736,776 Number of Sequences: 59808 Number of extensions: 260176 Number of successful extensions: 782 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -