BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31461 (760 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g38500.1 68418.m04654 hypothetical protein contains Pfam prof... 31 0.63 At4g39840.1 68417.m05645 expressed protein 29 4.4 >At5g38500.1 68418.m04654 hypothetical protein contains Pfam profile PF03754: Domain of unknown function (DUF313) Length = 411 Score = 31.5 bits (68), Expect = 0.63 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 22 LLWEQERERERDVSTHFRSLFLSNLLKFISHS 117 ++WE+E E + D + LF NL+KF+ HS Sbjct: 124 IIWEEEEEADEDSE---KRLFEKNLMKFVGHS 152 >At4g39840.1 68417.m05645 expressed protein Length = 451 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = -2 Query: 345 IV*IMRYLKDHLNIIKIECALDHTTEIKTSLAPSIYTYLSLSI*YNM*YV-YICTYHVNF 169 ++ I YL + +I+ + + +K A S TY+ L I + YV Y+ + Sbjct: 307 LIFIQIYLSIYFSILCLSSLVTGIEPLKFLYATSSSTYVCLQILQTLGYVFYLLLLLMYL 366 Query: 168 LQIFSFNCGFSL 133 + +FS +CG L Sbjct: 367 VLVFSTDCGLGL 378 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,554,924 Number of Sequences: 28952 Number of extensions: 177352 Number of successful extensions: 329 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -