BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31460 (720 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.94 SB_55804| Best HMM Match : Acyl_transf_1 (HMM E-Value=1.2e-07) 31 0.94 SB_10518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_20108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 31.1 bits (67), Expect = 0.94 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 318 PVIYLRCRSEEFCDCQWNTKSINR 389 PV+Y+RC ++C W+ KS +R Sbjct: 359 PVLYIRCEDPKYCPVLWHYKSSDR 382 >SB_55804| Best HMM Match : Acyl_transf_1 (HMM E-Value=1.2e-07) Length = 1306 Score = 31.1 bits (67), Expect = 0.94 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 318 PVIYLRCRSEEFCDCQWNTKSINR 389 PV+Y+RC ++C W+ KS +R Sbjct: 1128 PVLYIRCEDPKYCPVLWHYKSSDR 1151 >SB_10518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 194 VAICAFGQKNVIDMSIQIDLNIIVSFKEYGSKPAL 298 V I +FG K +S + N+++SF + G KP L Sbjct: 157 VGIVSFGDKTKQILSRTLGKNMLMSFMDVGKKPPL 191 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,845,071 Number of Sequences: 59808 Number of extensions: 355875 Number of successful extensions: 593 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 591 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -