BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31458 (477 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) 212 1e-55 SB_17063| Best HMM Match : Ribosomal_S17 (HMM E-Value=5.7e-06) 34 0.052 SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) 33 0.091 SB_39731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_51828| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) 28 4.5 SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) 28 4.5 SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) 27 6.0 >SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 212 bits (518), Expect = 1e-55 Identities = 100/148 (67%), Positives = 120/148 (81%), Gaps = 16/148 (10%) Frame = +3 Query: 3 AFQKQATVFLNRKGGM----KRKDMRHHKNVGLGFKTP------------REAIEGTYID 134 A+QKQA +F NRK + K+KD+R +NVGLGFKTP REAIEGTYID Sbjct: 8 AYQKQAPIFQNRKRVLGQVTKKKDLRFVRNVGLGFKTPKDVCNCTYLLPEREAIEGTYID 67 Query: 135 KKCPFTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCF 314 KKCPFTGNVSIRGRILTG+ + MKM+RTI+IRRDYLHY+ KYNRFEKRH+N++ H SPCF Sbjct: 68 KKCPFTGNVSIRGRILTGICRSMKMKRTIIIRRDYLHYIKKYNRFEKRHKNLAAHCSPCF 127 Query: 315 RDVEIGDIVTIGECRPLSKTVRFNVLKV 398 RD+ +GD++T+G+CRPLSKTVRFNVLKV Sbjct: 128 RDIALGDLITVGQCRPLSKTVRFNVLKV 155 >SB_17063| Best HMM Match : Ribosomal_S17 (HMM E-Value=5.7e-06) Length = 73 Score = 34.3 bits (75), Expect = 0.052 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +3 Query: 330 GDIVTIGECRPLSKTVRFNVLKV 398 GD+V I ECRPLSK +FNV ++ Sbjct: 29 GDVVRIKECRPLSKMKKFNVEEI 51 >SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) Length = 208 Score = 33.5 bits (73), Expect = 0.091 Identities = 22/83 (26%), Positives = 39/83 (46%) Frame = +3 Query: 150 TGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDVEI 329 T + R ++ G+V KM +TI + + P Y + + + H + + Sbjct: 5 TAERTTRRKVREGLVVSDKMNKTITVMVEDRVKHPLYGKVMTKSVRLKAHDEN--NEAGM 62 Query: 330 GDIVTIGECRPLSKTVRFNVLKV 398 GD V I E RPLS T R+ ++++ Sbjct: 63 GDRVRIMETRPLSATKRWRLVEI 85 >SB_39731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 132 QCRYPQSPLWEF*SLNQHSYGDACP 58 +C QS LWE SL QH Y + P Sbjct: 505 KCNALQSSLWELKSLQQHYYPEVSP 529 >SB_51828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 28.3 bits (60), Expect = 3.4 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 323 HVPEARRQMHGHIPVPFLEP 264 HV +A R HG++P+P L P Sbjct: 82 HVDQACRSFHGNLPLPVLAP 101 >SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) Length = 525 Score = 27.9 bits (59), Expect = 4.5 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +3 Query: 177 ILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCF 314 I+ VV K K + VI RD+ Y ++ +R VH SP F Sbjct: 64 IMNKVVPKEKEDKNKVITRDHQAYFAFSCKYHRRMVLTVVHFSPSF 109 >SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) Length = 378 Score = 27.9 bits (59), Expect = 4.5 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = +3 Query: 3 AFQKQATVFLNRKGGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKK-CPFTGNVSIRGRI 179 A + T ++RK K+K+ + KN+ K PR T++ + G V++R R Sbjct: 217 ALAMKVTSRVSRKIDSKKKNKQRRKNLRALRKAPRRPAPVTHLSARGADVDGAVALRARA 276 Query: 180 LTGVVQK 200 G Q+ Sbjct: 277 RAGNAQR 283 >SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) Length = 732 Score = 27.5 bits (58), Expect = 6.0 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -2 Query: 389 NIESNCFGQRSAFADRYNIT-NLHVPEARRQMHGHIPVPFLEPIVFG*VVKVIAADHDSS 213 N+ ++ S + YNIT NLH+ E P+P FG + + A D++ S Sbjct: 76 NLMADLSSDGSEVSKTYNITINLHLMEVLSSDGNESPIPRKGTFDFGGMQDIAALDYEES 135 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,017,398 Number of Sequences: 59808 Number of extensions: 278296 Number of successful extensions: 654 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 989515521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -