BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0741 (541 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) 28 5.6 SB_15614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 >SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) Length = 3342 Score = 27.9 bits (59), Expect = 5.6 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = -1 Query: 415 VLYSGRSXIGNFSSGRRSRCYLLHEPEIGSLSICLKLTCNQ 293 +++ G + G FS+G+ + + +GS+ IC+KL C + Sbjct: 1270 LIHEGVTLRGGFSAGK-----FIAQGHVGSMQICIKLCCRR 1305 >SB_15614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 223 Score = 27.9 bits (59), Expect = 5.6 Identities = 17/60 (28%), Positives = 30/60 (50%) Frame = -2 Query: 492 SASWCIRLNTGSQPAVSTVIMRSMKKSCTVGALXSGTFLPAGGVAVISCTSPRSVRLASV 313 ++ W IR G P+V+ I + + T+ S FLP+ + ++ T PR+ +SV Sbjct: 12 TSPWQIRPAYGFAPSVTLPISLRLCSASTLELSNSFNFLPSQTSSPVAKTQPRNSSTSSV 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,136,573 Number of Sequences: 59808 Number of extensions: 256699 Number of successful extensions: 507 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -