BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0734 (701 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17334| Best HMM Match : WD40 (HMM E-Value=3.1e-30) 74 1e-13 SB_26977| Best HMM Match : WD40 (HMM E-Value=1.9e-10) 50 2e-06 SB_17106| Best HMM Match : FYVE (HMM E-Value=5e-17) 40 0.001 SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_45927| Best HMM Match : WD40 (HMM E-Value=9e-18) 39 0.005 SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24) 38 0.006 SB_36541| Best HMM Match : WD40 (HMM E-Value=0) 36 0.024 SB_34659| Best HMM Match : WD40 (HMM E-Value=1.1e-34) 36 0.042 SB_54574| Best HMM Match : WD40 (HMM E-Value=0) 35 0.073 SB_39216| Best HMM Match : WD40 (HMM E-Value=1.1e-14) 35 0.073 SB_44731| Best HMM Match : WD40 (HMM E-Value=1.1e-11) 33 0.17 SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_38341| Best HMM Match : TFIID_90kDa (HMM E-Value=4.6e-19) 33 0.22 SB_57808| Best HMM Match : WD40 (HMM E-Value=2.5e-22) 33 0.30 SB_40185| Best HMM Match : WD40 (HMM E-Value=0) 33 0.30 SB_18573| Best HMM Match : WD40 (HMM E-Value=1.5e-06) 32 0.39 SB_11169| Best HMM Match : WD40 (HMM E-Value=5.5001e-42) 32 0.39 SB_52725| Best HMM Match : WD40 (HMM E-Value=2.1e-22) 32 0.52 SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_8844| Best HMM Match : WD40 (HMM E-Value=2.5e-28) 32 0.52 SB_30344| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_39225| Best HMM Match : NIF (HMM E-Value=0) 31 0.90 SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_762| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_34371| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_19094| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_5612| Best HMM Match : WD40 (HMM E-Value=4.4e-18) 31 0.90 SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) 31 0.90 SB_35708| Best HMM Match : WD40 (HMM E-Value=1.2) 31 1.2 SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_1950| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_47540| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_52292| Best HMM Match : WD40 (HMM E-Value=1.6e-09) 29 2.8 SB_50716| Best HMM Match : WD40 (HMM E-Value=0) 29 2.8 SB_46083| Best HMM Match : WD40 (HMM E-Value=3.5e-18) 29 2.8 SB_58364| Best HMM Match : WD40 (HMM E-Value=2.8026e-45) 29 2.8 SB_31403| Best HMM Match : PAN (HMM E-Value=2.7e-18) 29 2.8 SB_9467| Best HMM Match : PAN (HMM E-Value=3e-05) 29 2.8 SB_42943| Best HMM Match : WD40 (HMM E-Value=0) 29 3.6 SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_35567| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_32324| Best HMM Match : WD40 (HMM E-Value=6.4e-21) 29 3.6 SB_27457| Best HMM Match : 7tm_1 (HMM E-Value=2.3e-17) 29 4.8 SB_19792| Best HMM Match : SspH (HMM E-Value=6.6) 29 4.8 SB_8327| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_10949| Best HMM Match : WD40 (HMM E-Value=3.1e-10) 29 4.8 SB_1661| Best HMM Match : WD40 (HMM E-Value=5e-13) 29 4.8 SB_45648| Best HMM Match : WD40 (HMM E-Value=2.4e-14) 28 6.4 SB_41991| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_27600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_26997| Best HMM Match : WD40 (HMM E-Value=1.3e-08) 28 6.4 SB_23517| Best HMM Match : WD40 (HMM E-Value=0) 28 6.4 SB_9416| Best HMM Match : WD40 (HMM E-Value=0) 28 6.4 SB_6741| Best HMM Match : WD40 (HMM E-Value=0) 28 6.4 SB_24139| Best HMM Match : WD40 (HMM E-Value=8.29989e-42) 28 6.4 SB_22042| Best HMM Match : WD40 (HMM E-Value=6.1e-13) 28 6.4 SB_3333| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_38040| Best HMM Match : F5_F8_type_C (HMM E-Value=8.4e-30) 28 8.4 SB_46904| Best HMM Match : Pentaxin (HMM E-Value=0.13) 28 8.4 >SB_17334| Best HMM Match : WD40 (HMM E-Value=3.1e-30) Length = 1292 Score = 74.1 bits (174), Expect = 1e-13 Identities = 35/58 (60%), Positives = 46/58 (79%) Frame = +1 Query: 256 DSLRQEAETLKNAIRDARKAACDTSLAQATSNLEPIGRIQMRTRRTLRGHLAKIYAMH 429 + LRQE+E LK IRDARK A DT+LAQ ++N++ +GRIQMRTRRTLRG L I +++ Sbjct: 5 EQLRQESEALKCQIRDARKIAADTTLAQVSANIDQVGRIQMRTRRTLRGGLDNICSIY 62 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 Query: 586 GGLDNICSIYS*RRAKATAPVPR 654 GGLDNICSIYS + + V R Sbjct: 53 GGLDNICSIYSLKTREGNVRVSR 75 >SB_26977| Best HMM Match : WD40 (HMM E-Value=1.9e-10) Length = 345 Score = 49.6 bits (113), Expect = 2e-06 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Frame = +1 Query: 328 SLAQATSNLEPIGRIQMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQ--DGKLIVWDSHT 501 ++ + LE + M+ RR L+GH K+ +M W D R+LVS+SQ D ++WD Sbjct: 199 TVKDVSRKLESLQGCHMKVRRILKGHQGKVLSMDWSGDCRHLVSSSQGCDRAALIWDIR- 257 Query: 502 TNRCTRSRCAH 534 T R S +H Sbjct: 258 TGRIVNSFASH 268 >SB_17106| Best HMM Match : FYVE (HMM E-Value=5e-17) Length = 289 Score = 40.3 bits (90), Expect = 0.001 Identities = 15/40 (37%), Positives = 27/40 (67%) Frame = +1 Query: 373 QMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWD 492 Q T L+GH++K+ A+ + + S+ L+S +DG ++VWD Sbjct: 119 QQGTAFELQGHISKVQALCFAAHSKKLISCGEDGAIMVWD 158 >SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 388 RTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDS 495 + LRGH+ +Y + W D L+S S D I+WD+ Sbjct: 174 KMLRGHIEDVYDLAWSPDGTQLLSGSVDNSAIIWDA 209 >SB_45927| Best HMM Match : WD40 (HMM E-Value=9e-18) Length = 1764 Score = 38.7 bits (86), Expect = 0.005 Identities = 25/77 (32%), Positives = 41/77 (53%) Frame = +1 Query: 268 QEAETLKNAIRDARKAACDTSLAQATSNLEPIGRIQMRTRRTLRGHLAKIYAMHWGSDSR 447 Q +E+L +RDA + C SL + + L P G + +TL GH +Y + +D Sbjct: 1017 QLSESLAGLLRDALQP-CVPSLVPSRAFLTPPGG---QLTQTLVGHSKGVYGLAVTADGS 1072 Query: 448 NLVSASQDGKLIVWDSH 498 +VS S+DG + VW ++ Sbjct: 1073 CVVSGSEDGSVKVWSAN 1089 >SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24) Length = 208 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHT 501 +LRGH+ +Y + W +D R + S S D L VWD T Sbjct: 96 SLRGHVNCVYQIAWSADCRLICSGSADSTLKVWDMKT 132 >SB_36541| Best HMM Match : WD40 (HMM E-Value=0) Length = 1070 Score = 36.3 bits (80), Expect = 0.024 Identities = 19/63 (30%), Positives = 36/63 (57%) Frame = +1 Query: 346 SNLEPIGRIQMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRCTRSR 525 +N++ +++ + TL+GH + I+A+ D +VSAS+D L VW + + CT++ Sbjct: 442 NNIKVWDLVRLECQATLKGHTSLIWAIAVSRDDSVIVSASKDDLLKVWRTESW-VCTQTL 500 Query: 526 CAH 534 H Sbjct: 501 IGH 503 Score = 31.9 bits (69), Expect = 0.52 Identities = 27/101 (26%), Positives = 43/101 (42%), Gaps = 1/101 (0%) Frame = +1 Query: 235 CINHERADSLRQE-AETLKNAIRDARKAACDTSLAQATSNLEPIGRIQMRTRRTLRGHLA 411 C+ E R + A T +D + + A T L + ++ R LRGH Sbjct: 620 CVTGECVTIARHDGAVTCAQVTQDGTQVVSGS--ADGTVRLHSV--LRDRDGMVLRGHDK 675 Query: 412 KIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRCTRSRCAH 534 + A+ +D R+LVS S+D + +WD T C + H Sbjct: 676 GVTALLIMNDCRHLVSGSKDSTIRLWDL-TKGECKQVMQGH 715 >SB_34659| Best HMM Match : WD40 (HMM E-Value=1.1e-34) Length = 292 Score = 35.5 bits (78), Expect = 0.042 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 367 RIQMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWD 492 R + R L GH ++ + W D ++L S D KL+VW+ Sbjct: 133 RSPTQLERRLVGHRQEVCGLKWSPDHQHLASGGNDNKLLVWN 174 >SB_54574| Best HMM Match : WD40 (HMM E-Value=0) Length = 1050 Score = 34.7 bits (76), Expect = 0.073 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 373 QMRTRRTLRGHLAKIY-AMHWGSDSRNLVSASQDGKLIVWDSHTTN 507 + R TL GH K+ M + +D+R +++AS DG L VWD+ T N Sbjct: 873 EARVMYTLAGHTNKLRRCMFFNNDTR-ILTASLDGSLKVWDAKTGN 917 Score = 31.5 bits (68), Expect = 0.68 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHT 501 T + H +Y + SDS +VS D + VWDS + Sbjct: 505 TAKVHCGAVYCCKFSSDSSKVVSCGTDNHVKVWDSQS 541 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 400 GHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHT 501 GH ++++ + D VS S D + VWDS T Sbjct: 592 GHTQEVFSCSFSPDDTKAVSCSADRTVKVWDSKT 625 >SB_39216| Best HMM Match : WD40 (HMM E-Value=1.1e-14) Length = 867 Score = 34.7 bits (76), Expect = 0.073 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWD 492 TL GH +++++ W +D + L + S+D KL ++D Sbjct: 148 TLEGHNEQVFSLAWSADGKQLATFSRDKKLRIYD 181 >SB_44731| Best HMM Match : WD40 (HMM E-Value=1.1e-11) Length = 256 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +1 Query: 388 RTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRCTRS 522 R++RGH I+ M + D L S DG + VWD T S Sbjct: 175 RSVRGHTDTIHTMSFSPDGTLLASGGMDGAVRVWDFGQVRNTTLS 219 >SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1803 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 388 RTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTN 507 R+L GH ++ ++ + + + LVS + D KL VWD + N Sbjct: 1258 RSLEGHEDRVTSLAFSKNGKRLVSVALDKKLKVWDVESGN 1297 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 394 LRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHT 501 L GH + + D R + S S+D + VWDS T Sbjct: 1177 LSGHSKGVLTTCFSIDDRKIFSGSEDCTIRVWDSKT 1212 >SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/42 (28%), Positives = 27/42 (64%) Frame = +1 Query: 379 RTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTT 504 +T + RGH + + + + +D+ +++SAS DG + +W+ +T Sbjct: 340 KTLKEFRGHTSFVNDVIFTADAHHIISASSDGTIKIWNIKST 381 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 415 IYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRCTRSRCAH 534 + + + DS L S QDGK+ VW T R AH Sbjct: 267 VLCLTFSRDSEMLASGGQDGKIKVWKLQTGQCLRRFERAH 306 >SB_38341| Best HMM Match : TFIID_90kDa (HMM E-Value=4.6e-19) Length = 426 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQD 471 TLRGH +YA +GS+ + L+SAS+D Sbjct: 345 TLRGHSGPVYATCFGSEGKILLSASED 371 >SB_57808| Best HMM Match : WD40 (HMM E-Value=2.5e-22) Length = 195 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = +1 Query: 388 RTLRGHLAKIYAMHWGSDSRNLVSASQDGK--LIVWDSHTTN 507 +TLRGH A + + W LVS S+D + + +WD+ T N Sbjct: 149 KTLRGHGADVKCIDWHPHKSLLVSGSKDSQQPIKLWDTRTGN 190 >SB_40185| Best HMM Match : WD40 (HMM E-Value=0) Length = 503 Score = 32.7 bits (71), Expect = 0.30 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 394 LRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWD 492 L GH A + ++ + + R+L+S+ D +L+VWD Sbjct: 265 LSGHKAAVQSLAFSRNGRHLISSGVDTRLLVWD 297 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +1 Query: 349 NLEPIGRIQMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHT 501 N P + R L GH ++A+ D++ L+S S+D + +W T Sbjct: 64 NRIPFPEMTASESRRLVGHSGPVFAVSIDHDNKFLLSCSEDKTIRLWSLFT 114 >SB_18573| Best HMM Match : WD40 (HMM E-Value=1.5e-06) Length = 76 Score = 32.3 bits (70), Expect = 0.39 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRCTRSRCAH 534 TLRGH Y + D +V+ D ++VW +H T CT + H Sbjct: 28 TLRGHSEVAYCCQF--DDEKVVTGGGDNLIMVWSAH-TGECTATLSGH 72 >SB_11169| Best HMM Match : WD40 (HMM E-Value=5.5001e-42) Length = 383 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +1 Query: 388 RTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRC 513 RTLRGH + + + D+R + S S D + +W S +++C Sbjct: 182 RTLRGHQGAVNVVAFSLDNRYIFSGSDDKSIRIW-SRESSKC 222 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Frame = +1 Query: 388 RTLRGHLAKIY--AMHWGSDSRN--LVSASQDGKLIVWDSHTTNRCTR 519 RTL GH + A WG + L +AS+DG +I+W + R R Sbjct: 87 RTLVGHEKPVTNCAFMWGPSLKTPILATASEDGDVILWHYDSGKRAAR 134 >SB_52725| Best HMM Match : WD40 (HMM E-Value=2.1e-22) Length = 874 Score = 31.9 bits (69), Expect = 0.52 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 394 LRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNR 510 L+GH K+ + W D ++S DG + W+ + R Sbjct: 270 LKGHNGKVRQVIWSQDDSKIISCGMDGAVYEWNVYNYKR 308 >SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1649 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHT 501 +L GH + + SD R LVSASQD L +W+ T Sbjct: 827 SLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLET 863 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRCTRSRCAH 534 TLRGH +Y + D + +S S+D + +WD + RS H Sbjct: 869 TLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKE-VRSLVGH 915 Score = 31.1 bits (67), Expect = 0.90 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +1 Query: 349 NLEPIGRIQMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDS 495 NL P R + +L+ H + A+ + + R LVSA+QD I WD+ Sbjct: 1070 NLAPFSR-----KLSLKEHEYPVQALAFAEEGRCLVSAAQDNCFIAWDA 1113 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHT 501 TL+GH + + DS+ ++S+S D + +WD T Sbjct: 785 TLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVET 821 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 403 HLAKIYAMHWGSDSRNLVSASQDGKLIVWD 492 H + + + W D +L SAS D K+ WD Sbjct: 1451 HDSGVRTLAWSPDGLSLYSASTDNKIAHWD 1480 >SB_8844| Best HMM Match : WD40 (HMM E-Value=2.5e-28) Length = 539 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 361 IGRIQM-RTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWD 492 I I+M R RT GH +I + + D R L+S+S D + WD Sbjct: 437 IADIEMHRIVRTFTGHANRITDVSFSPDGRWLISSSMDSTIRTWD 481 >SB_30344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 31.5 bits (68), Expect = 0.68 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +1 Query: 379 RTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHT 501 R R TLRGH + ++ + S L+++S D L +WD+ T Sbjct: 278 RCRYTLRGHADSVNSIVFLPYSNTLLTSSADKTLSLWDART 318 >SB_39225| Best HMM Match : NIF (HMM E-Value=0) Length = 1772 Score = 31.1 bits (67), Expect = 0.90 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 400 GHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHT 501 GH + I + H + SR L+S D LI+WD T Sbjct: 79 GHTSIITSCHPNTTSRKLISGGWDKTLIMWDVET 112 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +1 Query: 388 RTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNR 510 + +RGH + + + D +V+AS D + +WD+ + N+ Sbjct: 33 KVMRGHTDSVNSCRFCFDDAKIVTASHDKTIRLWDASSGNQ 73 >SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 31.1 bits (67), Expect = 0.90 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +1 Query: 394 LRGHLAKIYAMHWGSD-SRNLVSASQDGKLIVWD 492 L+GH + Y + W + + NL+SAS D + +WD Sbjct: 239 LKGHTKEGYGLSWNPNVNGNLLSASDDHTICLWD 272 >SB_762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 31.1 bits (67), Expect = 0.90 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNR 510 TL GH I ++ + DS+ L++AS DG + ++D + + + Sbjct: 143 TLEGHAMPIRSLTFSPDSQLLITASDDGHIKMYDVYPSKQ 182 >SB_34371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 644 Score = 31.1 bits (67), Expect = 0.90 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRCTRSRCAH 534 TL GH + + M + +VS S+DG L VWD+ TT C H Sbjct: 394 TLYGHTSTVRCMDMHEEV--VVSGSRDGTLRVWDT-TTGNCLHVLVGH 438 Score = 30.3 bits (65), Expect = 1.6 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +1 Query: 376 MRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRCTRSRCAH 534 +R + L+GH + S SR +VS S DG L VW S + +C R+ H Sbjct: 308 LRPSKILKGHDDHVITCLQFSGSR-VVSGSDDGTLKVW-SALSGKCLRTLTGH 358 >SB_19094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 31.1 bits (67), Expect = 0.90 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +1 Query: 388 RTLRGHLAKIYAMHWGSDSRNL-VSASQDGKLIVWDS 495 RTL+GH + + ++L +SAS+DG +++WD+ Sbjct: 123 RTLKGHSDFVLGVDCSGTEKDLFLSASRDGSVVLWDT 159 >SB_5612| Best HMM Match : WD40 (HMM E-Value=4.4e-18) Length = 736 Score = 31.1 bits (67), Expect = 0.90 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 388 RTLRGHLAKIYAMHWGSDSRN-LVSASQDGKLIVWDSHT 501 R L GH ++ A+ W + LV++S DG VWD T Sbjct: 16 RQLVGHCGRVTALSWSPHHPDRLVTSSYDGSAQVWDVET 54 >SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) Length = 844 Score = 31.1 bits (67), Expect = 0.90 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +1 Query: 340 ATSNLEPIGRIQMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSH 498 +T + + Q R + L + YA+ DS+ S DG + VWD H Sbjct: 405 STLTIWDLASSQPRIKAELTSNAPACYALAMSPDSKVCFSCCSDGNIAVWDLH 457 >SB_35708| Best HMM Match : WD40 (HMM E-Value=1.2) Length = 179 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 388 RTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVW 489 +TL GH + + W + L ++ Q G +IVW Sbjct: 107 QTLEGHTGAVQVVTWNEQFQKLTTSDQYGLIIVW 140 >SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 784 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 421 AMHWGSDSRNLVSASQDGKLIVWDSHTTN 507 A +G + + +V+ S DG +WD +TTN Sbjct: 654 ANFFGDNGQYIVAGSDDGSFFMWDRNTTN 682 >SB_1950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 420 Score = 30.3 bits (65), Expect = 1.6 Identities = 22/83 (26%), Positives = 35/83 (42%) Frame = +1 Query: 388 RTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRCTRSRCAHXXXXXXXXXXX 567 +TLRGH +I D +V+ D ++VW +H T CT + H Sbjct: 253 QTLRGHTDEIEF-----DDEKVVTGGGDNLIMVWSAH-TGECTATLSGH-TGEVYCLAFN 305 Query: 568 XSYVACGGLDNICSIYS*RRAKA 636 +A G D+ I+S R ++ Sbjct: 306 DEIIASGSADSSVRIWSFRDGRS 328 >SB_47540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 373 QMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDS 495 Q R TLR H + + W D L S S D + +W++ Sbjct: 77 QWRCVHTLRQHSGDVLDLAWSPDDSFLASGSVDNTVTIWNA 117 >SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSH 498 TL H ++ + W D + L S D L +WD++ Sbjct: 286 TLDKHTQEVCGLKWSPDGKYLASGGNDNLLNIWDAN 321 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 394 LRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTN 507 L GH ++ M D + +VSA+ D L +W TT+ Sbjct: 423 LTGHSCRVLHMAMSPDGQTVVSAAADETLRLWKCFTTD 460 >SB_52292| Best HMM Match : WD40 (HMM E-Value=1.6e-09) Length = 743 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 403 HLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNR 510 H A I + W S LV+ +DG ++ W + R Sbjct: 82 HKAAIKTIEWNSSGNKLVTGDEDGTVVGWKADQKGR 117 >SB_50716| Best HMM Match : WD40 (HMM E-Value=0) Length = 494 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 388 RTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWD 492 R L GH + + + D++ +VS + DGK+ VWD Sbjct: 387 RVLEGHEELVRCIRF--DNKRIVSGAYDGKIKVWD 419 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 385 RRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHT 501 RR L GH A + + + D + +VSAS D + VW + T Sbjct: 306 RRVLVGHRAAVNVVDF--DDKYIVSASGDRTIKVWSTST 342 >SB_46083| Best HMM Match : WD40 (HMM E-Value=3.5e-18) Length = 246 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/71 (22%), Positives = 34/71 (47%), Gaps = 2/71 (2%) Frame = +1 Query: 322 DTSLAQATSNLEPIGRIQMRTRRTLRG--HLAKIYAMHWGSDSRNLVSASQDGKLIVWDS 495 D +L + N + R ++T T+ H +Y + + ++A ++GK+++WD Sbjct: 135 DNNLIYSAGNDDQAMRHDLKTGETVGVFIHDDPVYCLSIHPEDNVFLTACENGKVLMWDV 194 Query: 496 HTTNRCTRSRC 528 T + S+C Sbjct: 195 RTPTGSSPSQC 205 >SB_58364| Best HMM Match : WD40 (HMM E-Value=2.8026e-45) Length = 426 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 397 RGHLAKIYAMHWGSDSRNLVSASQDGKLIVWD 492 + H IY + W DS+ +++AS D +W+ Sbjct: 202 KAHSGGIYGLSWSDDSKFILTASGDKSCKIWN 233 >SB_31403| Best HMM Match : PAN (HMM E-Value=2.7e-18) Length = 1051 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 300 RCEESGMRHVAGPGHLEPGA 359 RCE SG H A P H PGA Sbjct: 489 RCELSGATHFAFPAHFTPGA 508 >SB_9467| Best HMM Match : PAN (HMM E-Value=3e-05) Length = 168 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 300 RCEESGMRHVAGPGHLEPGA 359 RCE SG H A P H PGA Sbjct: 70 RCELSGATHFAFPAHFTPGA 89 >SB_42943| Best HMM Match : WD40 (HMM E-Value=0) Length = 273 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 373 QMRTRRTLRGHLAKIYAMHWG-SDSRNLVSASQDGKLIVWD 492 Q+ R TL+GH + + S+ ++S+S+D KLIVW+ Sbjct: 41 QLSLRGTLKGHNGWVTQIATNPSNPDTILSSSRDKKLIVWE 81 Score = 28.3 bits (60), Expect = 6.4 Identities = 10/38 (26%), Positives = 23/38 (60%) Frame = +1 Query: 382 TRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDS 495 T R GH + ++ + +D+R +VS ++D + +W++ Sbjct: 134 TTRRFVGHTKDVLSVAFSADNRQIVSGARDHHIKLWNT 171 >SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNR 510 +L GH + + + + S +V+ SQ G L +WD R Sbjct: 56 SLAGHTSPVECVQFNSGEDLVVAGSQSGTLKIWDLEAAKR 95 >SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +1 Query: 124 GASIEGTLLTEGSVRCVLYVRGAG---LSIVCST*AVCDACINHERA-DSLRQEA 276 G S+E TL+ G +RC G L + C+ V +AC+ RA D+ R A Sbjct: 662 GCSVEATLVQTGVLRCFCPPHEPGLVTLQVACNGFIVSNACVFEYRARDTPRSNA 716 >SB_35567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 161 RCVACCTCAAPGCRSSVPRELCV 229 RC A C C GCR + RE V Sbjct: 42 RCTAPCVCTQEGCRKTFVREAAV 64 >SB_32324| Best HMM Match : WD40 (HMM E-Value=6.4e-21) Length = 123 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 373 QMRTRRTLRGHLAKIYAMHWG-SDSRNLVSASQDGKLIVWD 492 Q+ R TL+GH + + S+ ++S+S+D KLIVW+ Sbjct: 4 QLSLRGTLKGHNGWVTQIATNPSNPDTILSSSRDKKLIVWE 44 >SB_27457| Best HMM Match : 7tm_1 (HMM E-Value=2.3e-17) Length = 352 Score = 28.7 bits (61), Expect = 4.8 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -1 Query: 203 IDNPAPRTYNTQRTDPSVSNVPS-IDAPAIFGRFLYHH*DWITTFWH 66 I +PA T N ++T S++ V + I AP IFG F+ WIT H Sbjct: 18 IGSPADYTKNFKQTYVSLAVVNALIAAPTIFGNFVIILAVWITPALH 64 >SB_19792| Best HMM Match : SspH (HMM E-Value=6.6) Length = 244 Score = 28.7 bits (61), Expect = 4.8 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 5/89 (5%) Frame = +1 Query: 268 QEAETLKNAIRDARKAACDTSLAQA--TSNLEPIGRIQMRTRRTLRGHLAKIYAMHWGSD 441 Q A T N + D++KA T A T+++ ++ T+ A+IY H Sbjct: 24 QTARTYTNHMNDSQKARIYTQHAARIYTNHVNDSQTARIYTQHVNYSQTARIYTQHAARI 83 Query: 442 SRNLVSASQDGKLI---VWDSHTTNRCTR 519 NLV+ SQ ++ V DS T T+ Sbjct: 84 YTNLVNDSQTARIYTQHVIDSQTARIYTQ 112 >SB_8327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/37 (29%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +1 Query: 385 RRTLRGHLAKIYAMHWGSDSR-NLVSASQDGKLIVWD 492 + TL+GH +++ + + + ++S S DG++I+WD Sbjct: 55 QHTLKGHTSQVVGISADTTNELQVISCSGDGQVIMWD 91 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 400 GHLAKIYAMHWG-SDSRNLVSASQDGKLIVWDSHTTNRCTR 519 GH AKI W ++ L S S+D + VW H C + Sbjct: 900 GHTAKISDFSWNPNEPWVLCSVSEDNIMQVWQMHPCGLCNK 940 >SB_10949| Best HMM Match : WD40 (HMM E-Value=3.1e-10) Length = 193 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 430 WGSDSRNLVSASQDGKLIVWDSHTTN 507 W + RN+++ S DG + +WD N Sbjct: 47 WNKEDRNVLATSHDGDVRIWDLRKGN 72 >SB_1661| Best HMM Match : WD40 (HMM E-Value=5e-13) Length = 106 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 391 TLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHT 501 TL GH A+I + + S L++ S D + VWD+ + Sbjct: 18 TLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRS 54 >SB_45648| Best HMM Match : WD40 (HMM E-Value=2.4e-14) Length = 316 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 439 DSRNLVSASQDGKLIVWDSHTTNRCTRSRCAH-XXXXXXXXXXXXSYVACGGLDNICSIY 615 +S +VSAS D +L +W+ + + C R+ H YVACG +N +Y Sbjct: 156 NSTEIVSASTDSQLKLWNINKPH-CLRTFKGHINEKNFVGLASNGDYVACGSENNSLYLY 214 >SB_41991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 415 IYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRCTRS 522 I M + S R L+S +DG+L +W ++ C R+ Sbjct: 107 ITCMAFDSTERRLISGGRDGRLRIW-NYNNGHCIRT 141 >SB_27600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 893 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/75 (24%), Positives = 31/75 (41%) Frame = +2 Query: 80 LSNLNGDIEIARKSLERRSKGHC*QKDRCVACCTCAAPGCRSSVPRELCVTRVLIMNERT 259 ++N+ D + + + G+C + CV C +V + T + + E T Sbjct: 181 ITNIIPDANVVTRDDDHILVGNCKENATCVYVCYLVHKTITRTVSGVVAPTAIAVTEEGT 240 Query: 260 AYARRRKPLKTLLEM 304 + K LKTLL M Sbjct: 241 VFVSSSK-LKTLLTM 254 >SB_26997| Best HMM Match : WD40 (HMM E-Value=1.3e-08) Length = 175 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 394 LRGHLAKIYAMHWGSDSRNLVSASQDGKLIVW 489 L GH A + + W D L S +G +IVW Sbjct: 136 LLGHSAPVLDVCWNYDESLLASCDTEGTVIVW 167 >SB_23517| Best HMM Match : WD40 (HMM E-Value=0) Length = 860 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 394 LRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNR 510 L+GH + A+ + SD ++ D L +W+ H R Sbjct: 567 LQGHQGAVRAVRFNSDGNYCLTCGSDKILALWNPHKATR 605 >SB_9416| Best HMM Match : WD40 (HMM E-Value=0) Length = 700 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 394 LRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRC 513 L+GH+ + A+ SD + +S S DG + +W S RC Sbjct: 207 LKGHMDNVKAVVIDSDGQQCLSGSSDGTVRLW-SLGQQRC 245 >SB_6741| Best HMM Match : WD40 (HMM E-Value=0) Length = 714 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 394 LRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWD 492 L GH + + +S+ L+S S D I+WD Sbjct: 94 LEGHTGAVRVCRFSPNSQFLISGSADETFIIWD 126 >SB_24139| Best HMM Match : WD40 (HMM E-Value=8.29989e-42) Length = 198 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 394 LRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWD 492 L GH + + +S+ L+S S D I+WD Sbjct: 94 LEGHTGAVRVCRFSPNSQFLISGSADETFIIWD 126 >SB_22042| Best HMM Match : WD40 (HMM E-Value=6.1e-13) Length = 232 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +1 Query: 388 RTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRCTRSRC 528 R + GH I + +D +V+ S+D + VWD + C+ RC Sbjct: 170 RMVEGHSKMILCLDVCADGTKIVTGSKDHTVRVWD---VSDCSNPRC 213 >SB_3333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +1 Query: 415 IYAMHWGSDSRNLVSASQDGKLIVW 489 + +M W +DS N+++A QDG+ VW Sbjct: 2 VTSMAW-NDSTNMLAALQDGRFTVW 25 >SB_38040| Best HMM Match : F5_F8_type_C (HMM E-Value=8.4e-30) Length = 351 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 300 RCEESGMRHVAGPGHLEPGA 359 +C+ +G H A PGHL PGA Sbjct: 97 QCQLNGDTHFAFPGHLIPGA 116 >SB_46904| Best HMM Match : Pentaxin (HMM E-Value=0.13) Length = 323 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 397 RGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSHTTNRCTRSR 525 R HL + ++ WG N ++ S + +V+DS + CT R Sbjct: 259 RSHLTE--SLLWGCYYSNALTTSIENNAVVYDSSVLSTCTSKR 299 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,398,782 Number of Sequences: 59808 Number of extensions: 441474 Number of successful extensions: 1558 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 1342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1558 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -