BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0723 (670 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54202| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.091 SB_15410| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_52342| Best HMM Match : ABC_tran (HMM E-Value=5.29999e-41) 28 6.0 >SB_54202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 34.3 bits (75), Expect = 0.091 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 Query: 259 SQVCSICLCVELPDVQGVPQPLCSNLSCGAYFHRTCLH 372 S C IC L D +P C + CG FHR CL+ Sbjct: 50 SMECGICYAYRLNDT--IPDKACDDPRCGQPFHRDCLY 85 >SB_15410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1147 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 293 YLMFKVCPSLYAAIYL-VEHIFTGPAYIWFILILIIYHSIFLIVYCV 430 YL F +Y + L V + G Y+WF+L++ IY S L V V Sbjct: 811 YLWFLSVVGIYGSFRLWVSIVPFGRVYLWFLLVVGIYGSFRLWVIMV 857 >SB_52342| Best HMM Match : ABC_tran (HMM E-Value=5.29999e-41) Length = 336 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = +2 Query: 290 NYLMFKVCPSLYAAIYLVEHIFTGPAYIWFILILIIYHSIFLIVYCVLVNF 442 +Y++F V P++ + + + F WF LI+ + +++LIV VL + Sbjct: 51 SYILFSVVPTIVDIVIAIVY-FIAAFNGWFGLIVFLTMALYLIVTIVLTEW 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,229,685 Number of Sequences: 59808 Number of extensions: 383665 Number of successful extensions: 893 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -