BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0718 (506 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 66 2e-11 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 54 9e-08 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 50 1e-06 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 8e-06 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 47 1e-05 SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) 46 1e-05 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 46 2e-05 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 38 0.006 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 37 0.008 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 36 0.025 SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.034 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.077 SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.077 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 33 0.10 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 33 0.10 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.10 SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 32 0.31 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 31 0.55 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) 31 0.55 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 31 0.55 SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 30 1.3 SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 30 1.3 SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 29 2.2 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) 29 2.2 SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) 29 2.2 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 2.9 SB_9399| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_56343| Best HMM Match : RRM_1 (HMM E-Value=3.2e-14) 28 3.8 SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 28 3.8 SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) 28 3.8 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_42035| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) 28 3.8 SB_2941| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) 28 5.1 SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_2375| Best HMM Match : Pentapeptide_2 (HMM E-Value=2.7) 28 5.1 SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) 27 6.7 SB_56231| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_39141| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_23339| Best HMM Match : I-set (HMM E-Value=1.3e-07) 27 6.7 SB_20262| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_19847| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_15580| Best HMM Match : Pentapeptide (HMM E-Value=0.2) 27 6.7 SB_40510| Best HMM Match : Y_phosphatase (HMM E-Value=0) 27 8.9 SB_38604| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_23644| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) 27 8.9 SB_54036| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 27 8.9 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 27 8.9 SB_25551| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_23204| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_23116| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 66.1 bits (154), Expect = 2e-11 Identities = 31/76 (40%), Positives = 50/76 (65%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSE 450 V DP T RSRGF F+ FK P+++D V+ +G +++D KK KIF+GGLS+ Sbjct: 139 VMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGA-----QELDGKKMVTTTKKIFIGGLSTN 193 Query: 451 ISDDEIRNFFSEFGTI 498 S+++++ +FS+FG + Sbjct: 194 TSEEDMKKYFSQFGKV 209 Score = 29.9 bits (64), Expect = 1.3 Identities = 9/26 (34%), Positives = 20/26 (76%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYGE 256 +K+F+GGLS T+ ++++ +F +G+ Sbjct: 183 KKIFIGGLSTNTSEEDMKKYFSQFGK 208 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 53.6 bits (123), Expect = 9e-08 Identities = 23/75 (30%), Positives = 50/75 (66%), Gaps = 11/75 (14%) Frame = +1 Query: 292 GRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK-----------AKARHGKIFVGG 438 GRSRGF F+ +++ +S+++V+ +H +++++++PK+ A ++ KIFVGG Sbjct: 86 GRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGG 145 Query: 439 LSSEISDDEIRNFFS 483 L+S +++I+ +F+ Sbjct: 146 LASTTVEEDIKEYFN 160 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +1 Query: 265 INVKTD-PNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAK 408 +++K D N R RGFAF+ F E ++KV A H I K+ + KKA+ Sbjct: 174 VDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAE 222 Score = 37.9 bits (84), Expect = 0.005 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYG 253 RK+F+GGL+W TT + L+D+F +G Sbjct: 50 RKIFIGGLNWNTTEEGLKDYFSQWG 74 Score = 33.5 bits (73), Expect = 0.10 Identities = 11/28 (39%), Positives = 24/28 (85%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 KIF+GGL+ +++ ++++FS++GTI++ Sbjct: 51 KIFIGGLNWNTTEEGLKDYFSQWGTIVD 78 Score = 27.1 bits (57), Expect = 8.9 Identities = 9/23 (39%), Positives = 18/23 (78%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGA 247 RK+FVGGL+ T ++++++F + Sbjct: 139 RKIFVGGLASTTVEEDIKEYFNS 161 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 52.0 bits (119), Expect = 3e-07 Identities = 29/88 (32%), Positives = 45/88 (51%), Gaps = 5/88 (5%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD-----PKKAKARHG 420 I+ VK DPNT RSRGF F+ FK E V++ H I + + PK+ Sbjct: 141 IDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLST-SHRIQGRLCEVRLPRPKEELNVPK 199 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVG L ++ + +F++FG + + Sbjct: 200 KLFVGRLPESTTEKTLMEYFAQFGEVTD 227 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYGE 256 +KLFVG L TT K L ++F +GE Sbjct: 199 KKLFVGRLPESTTEKTLMEYFAQFGE 224 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 50.0 bits (114), Expect = 1e-06 Identities = 29/74 (39%), Positives = 38/74 (51%) Frame = +1 Query: 265 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLS 444 +++K D TGR RGFAF+ FK D + I K R KIFVGGL Sbjct: 58 VDIKMDALTGRPRGFAFVQFKHQSEADAIDPKPAAPIG------KPPHLRVKKIFVGGLK 111 Query: 445 SEISDDEIRNFFSE 486 E SD++IR +F + Sbjct: 112 PETSDEKIREYFGK 125 Score = 47.6 bits (108), Expect = 6e-06 Identities = 22/43 (51%), Positives = 27/43 (62%) Frame = +2 Query: 128 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 G S D N DD KLFVGGLS+ETT + L+++F YGE Sbjct: 12 GTSLDSNKTRMTKDDDIGKLFVGGLSYETTKESLKEYFSKYGE 54 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 ++ I T+ ++ R RGF F+ F + +++DK+ H I KV+ K+A Sbjct: 130 VKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRA 179 Score = 34.7 bits (76), Expect = 0.044 Identities = 12/28 (42%), Positives = 22/28 (78%) Frame = +1 Query: 418 GKIFVGGLSSEISDDEIRNFFSEFGTIL 501 GK+FVGGLS E + + ++ +FS++G ++ Sbjct: 29 GKLFVGGLSYETTKESLKEYFSKYGELV 56 Score = 30.7 bits (66), Expect = 0.72 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFG 244 +K+FVGGL ET+ +++R++FG Sbjct: 103 KKIFVGGLKPETSDEKIREYFG 124 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 47.2 bits (107), Expect = 8e-06 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 21/87 (24%) Frame = +1 Query: 301 RGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---------------------KARH 417 +GF F+ F+ P +I+ V+A H ++ K +DPK A A Sbjct: 142 KGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPRGPGQQAQTGAVMGGPQRGSAND 201 Query: 418 GKIFVGGLSSEISDDEIRNFFSEFGTI 498 GK+F+GGL+ ++++++ +FS +G + Sbjct: 202 GKVFIGGLAFGTTEEDLKEYFSTYGMV 228 Score = 36.3 bits (80), Expect = 0.015 Identities = 13/30 (43%), Positives = 23/30 (76%) Frame = +2 Query: 164 GRDDDRKLFVGGLSWETTXKELRDHFGAYG 253 G +D K+F+GGL++ TT ++L+++F YG Sbjct: 197 GSANDGKVFIGGLAFGTTEEDLKEYFSTYG 226 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 46.8 bits (106), Expect = 1e-05 Identities = 25/69 (36%), Positives = 37/69 (53%) Frame = +1 Query: 292 GRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIR 471 G SR + F++FK + K + H IN K VD K++ I+VGGL S ++ +R Sbjct: 117 GYSRNYGFVLFK-DDGPSKEVLKKSHVINGKTVDVGKSR-NFRVIYVGGLPSHFTEQTVR 174 Query: 472 NFFSEFGTI 498 F +FG I Sbjct: 175 EHFKKFGVI 183 Score = 33.1 bits (72), Expect = 0.14 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +1 Query: 376 NNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 N+ PK + +FVGGL+S ++ ++++F +FG + Sbjct: 66 NSTLPSPKDIEKNSRSVFVGGLASGTDEEGLKDYFEQFGEV 106 Score = 32.3 bits (70), Expect = 0.24 Identities = 11/45 (24%), Positives = 25/45 (55%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 390 + +++ TD TG+S+G + + P +++K++ H I +V Sbjct: 345 VAKVHILTDRETGKSKGCGVVKLRHPGTVNKILEEPVHVIGKSQV 389 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 173 DDRKLFVGGLSWETTXKELRDHFGAYGE 256 + R +FVGGL+ T + L+D+F +GE Sbjct: 78 NSRSVFVGGLASGTDEEGLKDYFEQFGE 105 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYGE 256 +KL V L ++TT ELR++F GE Sbjct: 236 KKLMVQDLDFDTTVDELREYFEKCGE 261 >SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) Length = 343 Score = 46.4 bits (105), Expect = 1e-05 Identities = 21/70 (30%), Positives = 40/70 (57%) Frame = +1 Query: 289 TGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEI 468 +G+S+GFAF+ + E+++ V+ +H I+N V +K + + K+ + + S I + +I Sbjct: 79 SGKSKGFAFVRLRKKEAVESVLGRDDHVIDNSDVSMEK-QDTYRKVILKNIPSSIGESQI 137 Query: 469 RNFFSEFGTI 498 FS G I Sbjct: 138 LEHFSSSGEI 147 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 45.6 bits (103), Expect = 2e-05 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 414 D T R RGF F+ F++ S DK H INNKKV+ KKA+ + Sbjct: 5 DKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 41.9 bits (94), Expect = 3e-04 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +2 Query: 146 NSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 N E D KLFVGGL+ ETT + LR++F AYGE Sbjct: 3 NRQENTNNDPRAKLFVGGLNRETTNETLREYFEAYGE 39 Score = 34.3 bits (75), Expect = 0.059 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 15/87 (17%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVF---KAPESI--DKVMAAGEHTINNKKVDPKKAKARHG 420 + + V D T +SRGF ++ F K ++ DKV G H I+ K+V+ K+A R Sbjct: 40 LTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKV-ENGAHRIDGKEVEVKRAIPRDD 98 Query: 421 ----------KIFVGGLSSEISDDEIR 471 KIFVGGL + + ++I+ Sbjct: 99 NSATSHEKTKKIFVGGLPEDATKEDIQ 125 Score = 30.7 bits (66), Expect = 0.72 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGL+ E +++ +R +F +G + + Sbjct: 15 KLFVGGLNRETTNETLREYFEAYGELTD 42 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +1 Query: 295 RSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 414 + RGFAF+ + D++ + + K V+ KKA R Sbjct: 150 KHRGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPR 189 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 41.9 bits (94), Expect = 3e-04 Identities = 24/94 (25%), Positives = 47/94 (50%), Gaps = 6/94 (6%) Frame = +1 Query: 238 FWSIR*IESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNK--KVD---PK 399 F ++ + S + D TG+S G+AF+ + P+ +K V + NK KV P Sbjct: 47 FGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPS 106 Query: 400 KAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 501 + ++ +++ GL ++ ++E+ F FG I+ Sbjct: 107 STEIKNANLYISGLPKDMKEEEVEALFKPFGKII 140 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 40.3 bits (90), Expect = 9e-04 Identities = 26/84 (30%), Positives = 47/84 (55%), Gaps = 12/84 (14%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAAGE-HTINNKKVDPKKAKARHG--- 420 + S+++ P G+SR F F+ F + ID ++ E H+I+NK+V+ K+A R Sbjct: 39 VSSVSLAKTPE-GKSRKFCFVEFSNGSDIIDNIVFNFESHSIDNKQVEVKRAMPRDDPNE 97 Query: 421 -------KIFVGGLSSEISDDEIR 471 K+F+GGL E S+++++ Sbjct: 98 LAHVRTKKLFIGGLKDEHSEEDVK 121 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = +2 Query: 170 DDDR--KLFVGGLSWETTXKELRDHFGAYGE 256 DD + KLFVGGL+ +TT + +R +F ++ E Sbjct: 3 DDSKLMKLFVGGLNEDTTEETVRAYFKSFCE 33 Score = 28.3 bits (60), Expect = 3.8 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEF 489 K+FVGGL+ + +++ +R +F F Sbjct: 9 KLFVGGLNEDTTEETVRAYFKSF 31 Score = 28.3 bits (60), Expect = 3.8 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 265 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 I + D T + +G+ F+ F +DK+ + K V+ KKA Sbjct: 135 IKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKA 181 >SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 38.7 bits (86), Expect = 0.003 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 5/88 (5%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK----AKAR-HG 420 I ++ DP TG ++GFAF F S + + T+N+K + P + K+R + Sbjct: 179 IREFRLQMDPATGLNKGFAFCTFTEQTSAYQAIT----TLNDKDIRPGRRLAICKSRSNS 234 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 ++FV G+ S +EI FS+ T L+ Sbjct: 235 RLFVKGIPKRKSKEEIFQEFSKVTTDLQ 262 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 37.5 bits (83), Expect = 0.006 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +1 Query: 259 ESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 354 E++N+ TD TGR RGF F+ F + E ++K + Sbjct: 123 EAVNIITDRETGRPRGFGFVTFGSKEEMEKAI 154 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGG+ E DD +R FF++FG I E Sbjct: 11 KLFVGGIPYESGDDALRKFFAQFGEIRE 38 Score = 29.1 bits (62), Expect = 2.2 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE*R 262 KLFVGG+ +E+ LR F +GE R Sbjct: 11 KLFVGGIPYESGDDALRKFFAQFGEIR 37 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 36.7 bits (81), Expect = 0.011 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 22/102 (21%) Frame = +1 Query: 265 INVKTDPNTGRSRGFAFIVF-------KAPESIDKVMAAGEHTINN---KKVDPKKAKAR 414 + V DP +S+GF F+ F KA +D V G+ N +K +P + K Sbjct: 542 VRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNNPTQTKPL 601 Query: 415 ------------HGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 + ++VG L ++ D E++ FS++G+ILE Sbjct: 602 VWDDVFHQSSQLNTTVYVGNLPPDVKDYELQQMFSQYGSILE 643 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 35.5 bits (78), Expect = 0.025 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 423 I S+ V TDP G+S+GF F+ F+ PE ++ + + +N K++ ++ A K Sbjct: 135 IVSLKVMTDPE-GKSKGFGFVSFETPEEAEEAV----NVLNGKEIGGRRLWAGRAK 185 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 354 I S V D + G S+GF F+ F +PE K + Sbjct: 238 ISSAKVMKD-DKGNSKGFGFVCFSSPEEATKAV 269 >SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 35.5 bits (78), Expect = 0.025 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESI 342 +E++ + TD NTG+ R F F+ F +P S+ Sbjct: 483 LENVRIPTDKNTGQQRSFGFVEFSSPVSV 511 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 35.1 bits (77), Expect = 0.034 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 262 SINVKTDPNTGRSRGFAFIVFKAPESIDKVM 354 S+ V TD TGR RGF F+ F + + +DK + Sbjct: 37 SVKVITDRETGRPRGFGFVTFGSEDEMDKAI 67 Score = 27.5 bits (58), Expect = 6.7 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKV---MAAGEHTINNKKVDPKKAKARHGKI 426 + + V +D T R RGFAF+ F + ++++ + E + KV+ +++ + G Sbjct: 255 VVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQARSREQRGGG 314 Query: 427 FVGGLSS 447 GG S Sbjct: 315 RGGGYRS 321 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.9 bits (74), Expect = 0.077 Identities = 21/90 (23%), Positives = 41/90 (45%), Gaps = 7/90 (7%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVDPKKAKARH----- 417 + ++++ D T +G+ F+ F E D + + K + KA A + Sbjct: 39 VVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAHNKNLDV 98 Query: 418 -GKIFVGGLSSEISDDEIRNFFSEFGTILE 504 +F+G L +E+ + + + FS FG IL+ Sbjct: 99 GANLFIGNLDTEVDEKLLYDTFSAFGVILQ 128 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTIN 378 +++ + D +TG S+GFAFI F + ++ D + A G++ N Sbjct: 127 LQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCN 169 >SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 33.9 bits (74), Expect = 0.077 Identities = 22/70 (31%), Positives = 35/70 (50%) Frame = -1 Query: 365 SPAAMTLSIDSGALNTMKANPRDLPVFGSVFTLILSIHRMLQNDHGAPYXWSPSSAHQQK 186 SP A++ +D G +A +++P F TL L +H G P ++PSS H++ Sbjct: 371 SPDALSKGLDMGWGALSRAGVQEMPAFP---TLRLPLHPFASTGFGTPAFYNPSSYHRE- 426 Query: 185 VFCRHRVLGP 156 + VLGP Sbjct: 427 ---YYPVLGP 433 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 33.5 bits (73), Expect = 0.10 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 354 + + V TD TGR RGF F+ F + E ++K + Sbjct: 30 VVDVKVITDRETGRPRGFGFVTFGSKEEMEKAI 62 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 33.5 bits (73), Expect = 0.10 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 ++F+G L S + D ++ FS++GTILE Sbjct: 358 QVFIGNLPSGVKDADVNEVFSKYGTILE 385 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 33.5 bits (73), Expect = 0.10 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 185 LFVGGLSWETTXKELRDHFGAYGE*R 262 L+VGGL + T ++LRDHF +GE R Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFGELR 331 Score = 28.3 bits (60), Expect = 3.8 Identities = 8/25 (32%), Positives = 19/25 (76%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTI 498 ++VGGL ++++ ++R+ F +FG + Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFGEL 330 >SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 33.1 bits (72), Expect = 0.14 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = +1 Query: 331 PESI-DKVMAAGEHTIN-NKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 PE++ D+++ + ++N + D + K+FVGGL +I +DEI F FG++ Sbjct: 313 PENLADQIVPSLASSLNCSPNSDSEHIPRFSRKVFVGGLPPDIDEDEIHASFCRFGSL 370 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 31.9 bits (69), Expect = 0.31 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 +IFV G + E ++ E+R FF E+G + E Sbjct: 9 RIFVKGFNRETTESELRAFFEEYGVVKE 36 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 167 RDDDRKLFVGGLSWETTXKELRDHFGAYG 253 +D +++FV G + ETT ELR F YG Sbjct: 4 QDISKRIFVKGFNRETTESELRAFFEEYG 32 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 31.1 bits (67), Expect = 0.55 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVG +S ++++R FS FGTI E Sbjct: 215 KLFVGMISKHAKEEDLRVMFSPFGTIEE 242 Score = 28.7 bits (61), Expect = 2.9 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 173 DDRKLFVGGLSWETTXKELRDHFGAYG 253 DDRKLFVG +S ++LR F +G Sbjct: 212 DDRKLFVGMISKHAKEEDLRVMFSPFG 238 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 31.1 bits (67), Expect = 0.55 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 5/82 (6%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK-----AKARHG 420 I + DP +G ++GFAF F + + ++NK++ P K + Sbjct: 178 IYDFRLMIDPISGLTKGFAFCTFSNKDEAQNAV----KKLDNKEIRPGKRLGVCISVANS 233 Query: 421 KIFVGGLSSEISDDEIRNFFSE 486 ++FVG + S EI FS+ Sbjct: 234 RLFVGSIPKTKSKQEILEEFSK 255 >SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) Length = 145 Score = 31.1 bits (67), Expect = 0.55 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +1 Query: 289 TGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV--DPK 399 TG+S+GF ++ ++ ES + + AG H I+ K V +PK Sbjct: 99 TGKSKGFGYVTYENAESAQRAL-AGTHIIDGKWVIAEPK 136 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 31.1 bits (67), Expect = 0.55 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESI 342 +E +++ D +GRSRGF F++ ++ + I Sbjct: 34 VEKVDILRDKESGRSRGFGFVLLQSADQI 62 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 31.1 bits (67), Expect = 0.55 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTI 498 KIF+GGL + +++D+++ S FG + Sbjct: 674 KIFIGGLPNYLNEDQVKELLSSFGEL 699 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 31.1 bits (67), Expect = 0.55 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 382 KKVDPK--KAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 KK+ PK + + G I++G + ++EI+ FF +FGT+ Sbjct: 84 KKIKPKGDEDELSPGVIYLGHIPHGFFENEIKKFFEQFGTV 124 >SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 0.72 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 62 NDNFAQDITTDNQLNGNAENGGGDSQDH-NSAEAPGRDDD 178 ND+ DI D+ NGN + G D+ D N E G DDD Sbjct: 20 NDDDGDDIDDDDG-NGNGNDNGDDNDDDDNDDEGNGDDDD 58 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 30.3 bits (65), Expect = 0.95 Identities = 19/76 (25%), Positives = 35/76 (46%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSE 450 V +P G SRGFAF+ + E +K G+ N ++V+ + +G G + Sbjct: 237 VAINPANGGSRGFAFVDYATAEEAEK----GQRAHNGRQVEGSNIRVAYGS--PGRTGAS 290 Query: 451 ISDDEIRNFFSEFGTI 498 I ++ N + + T+ Sbjct: 291 ILGSQLDNTQAGYTTV 306 >SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 30.3 bits (65), Expect = 0.95 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 8/59 (13%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKL--------FVGGLSWE 211 NN+N D +DN + N++N ++ D+N+ R D ++ ++ GL+WE Sbjct: 613 NNNNNNNDNNSDNNSDNNSDNNSDNNSDNNNDNNSERGADPEIKRGKNPEGWIRGLNWE 671 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 NNDN + + +N N N N ++ D+NS + D Sbjct: 597 NNDNNSDNNNNNNNNNNNNNNNNDNNSDNNSDNNSDNNSD 636 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 NNDN + + +N N N N ++ D+NS + D Sbjct: 593 NNDNNNDNNSDNNNNNNNNNNNNNNNNDNNSDNNSDNNSD 632 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDR 181 NN+N + DN + N++N ++ D+NS + +R Sbjct: 609 NNNNNNNNNNNDNNSDNNSDNNSDNNSDNNSDNNNDNNSER 649 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +2 Query: 122 GGGDSQDHNSAEA-PGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 GGG +++ E PG R LFVG + TT +L++ F YGE Sbjct: 231 GGGSISNYSEDEFDPGCT--RTLFVGNIEKTTTYGDLKEAFERYGE 274 >SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 NN+N + +N N N N ++ D NS E DDD Sbjct: 18 NNNNNNNNNNNNNNNNNNNNNNNNNNNDDNSDEDDDDDDD 57 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 NN+N + +N N N N ++ ++N+ + DDD Sbjct: 14 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDDNSDEDDD 53 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 NN+N + +N N N N D+ D + + DDD Sbjct: 22 NNNNNNNNNNNNNNNNNNNNNNNDDNSDEDDDDDDDDDDD 61 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 354 ++++++ TD SRGFA++ + PE +K + Sbjct: 1183 VKTVDLPTDRTNNLSRGFAYVEYVDPEECEKAL 1215 >SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +1 Query: 379 NKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 501 +K + K + K+FVG + ++ E+++FF FG ++ Sbjct: 66 SKDISKYKVVSNKCKVFVGNIGFKVRARELKDFFGYFGDVV 106 Score = 29.5 bits (63), Expect = 1.7 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVG + ++ +EL+D FG +G+ Sbjct: 80 KVFVGNIGFKVRARELKDFFGYFGD 104 >SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAE-NGGGDSQDHNS 151 NND+ D T D+ N N + NGGG D+N+ Sbjct: 193 NNDDDDDDDTDDDDHNNNDDDNGGGGDDDNNN 224 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 NN N TT+N N N N D D + +DD Sbjct: 173 NNINTTTTTTTNNNNNNNNNNNDDDDDDDTDDDDHNNNDD 212 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/69 (17%), Positives = 32/69 (46%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVG 435 +ES+ + D TG +GF +++F++ +++ + +K+ +K + F+ Sbjct: 82 VESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNNAEFKGRKIRVFPSKDKPQTEFIS 141 Query: 436 GLSSEISDD 462 + D+ Sbjct: 142 HIQVRFRDN 150 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.1 bits (62), Expect = 2.2 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 62 NDNFAQDITTDNQLN-GNAENGGGDSQDHNS 151 +DNF DI+ D LN G A N + ++NS Sbjct: 335 HDNFNDDISNDGNLNGGGANNNNNKNNNYNS 365 >SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 621 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 I+ + K+ N G++ G AF+VFK+ K + I ++ ++ Sbjct: 361 IDLLKHKSGKNQGKNTGVAFVVFKSNNDASKALKMDRSYIGHRYIE 406 >SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) Length = 189 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 NN+N +I +N N N N ++ ++N+ + DDD Sbjct: 112 NNNNNNNNINNNNNNNNNNNNNNNNNNNNNNNDDDDDDDD 151 >SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) Length = 244 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +2 Query: 56 ANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 A N+ +A+ +T +N N N N ++ ++N+ DDD Sbjct: 160 AINEKYAKIMTDNNNNNNNNNNNNNNNNNNNNNNNNNNDDD 200 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPES 339 + + V TD TGR RGF F+ +A ++ Sbjct: 107 VVDVRVITDRETGRPRGFGFVTLEAKKT 134 >SB_9399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 651 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 287 FGSVFTLILSIHRMLQNDH--GAPYXWSPSSAHQQKVFCRHRVLGPQHCYDLAN 132 +G V +L + R LQ H P W P QQK++ + D +N Sbjct: 109 YGGVLSLTDDVMRQLQEKHPNAQPLSWDPCCLAQQKMYTSQSITDAVMLVDASN 162 >SB_56343| Best HMM Match : RRM_1 (HMM E-Value=3.2e-14) Length = 273 Score = 28.3 bits (60), Expect = 3.8 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 Query: 131 DSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYG 253 +++D + E G+ LFVG L ++ T +++ DHF G Sbjct: 58 ETEDVITKEQDGKKQRYILFVGNLPFDLTTEKVLDHFRCAG 98 >SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 28.3 bits (60), Expect = 3.8 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 ++DN D DN NG+ ++ D D + +A DDD Sbjct: 61 DSDNNYDDNDDDNDDNGDDDDNDDDDDDDDDDDADDDDDD 100 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 28.3 bits (60), Expect = 3.8 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTIL 501 +FVG + E S+++++ FSE G ++ Sbjct: 27 VFVGNIPYEASEEQLKEIFSEVGPVI 52 >SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +2 Query: 65 DNFAQDITTDNQLNGNAENGG-GDSQDHNSAEAPGRDDD 178 D + D D+ + + +N G GD D+ AE G DDD Sbjct: 821 DYYYDDDDDDDDDDDDGDNDGDGDGDDYGDAENYGEDDD 859 >SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) Length = 599 Score = 28.3 bits (60), Expect = 3.8 Identities = 9/30 (30%), Positives = 22/30 (73%) Frame = +2 Query: 62 NDNFAQDITTDNQLNGNAENGGGDSQDHNS 151 ND+ A D++ ++ + G+ +NGG D+ ++++ Sbjct: 180 NDDSASDVSIEDIIYGDDDNGGDDNDNYDN 209 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 391 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 DPK + +FVG L + IS ++R F +FG +L+ Sbjct: 232 DPKATRT----LFVGNLETGISCQDLRLSFEKFGVVLD 265 >SB_42035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -2 Query: 181 SVVIASWGLSTVMILRITATVLCISIKLV 95 ++++ S G++ L ITAT+LC SI L+ Sbjct: 267 TILLESSGVTLPKALHITATILCYSISLL 295 >SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) Length = 691 Score = 28.3 bits (60), Expect = 3.8 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQD 142 +++++A D DN +NG+ ++GGGD D Sbjct: 585 DDEDYAGD--GDNDVNGDGDSGGGDDDD 610 >SB_2941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.3 bits (60), Expect = 3.8 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAE----NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWE 211 +ND D D+++NG + N GGD D + + DDD + G S++ Sbjct: 58 DNDGGDDDDDDDDEVNGGNDDDDFNNGGDCDDDDDDDDDDDDDDDDINKKGASYD 112 >SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) Length = 557 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 +N+N +DI N EN GG+S + N + DD+ Sbjct: 147 SNNNEDEDIQEVEDDNEGKENDGGESDEENDDDDEDGDDE 186 >SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGN--AENGGGDSQDHN 148 NNDN+ + DN N N NG DS D+N Sbjct: 90 NNDNYDNNGNNDNNDNYNNYDNNGNNDSNDNN 121 >SB_2375| Best HMM Match : Pentapeptide_2 (HMM E-Value=2.7) Length = 521 Score = 27.9 bits (59), Expect = 5.1 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 56 ANNDNFAQDITTDNQLNGNAENGGGD-SQDHNSAEAPGRDDDRK 184 +N+DN D +T N N N EN D S +NS + DD K Sbjct: 103 SNSDNSNTDNSTSN--NSNPENSTSDNSNSNNSNQDNSNSDDSK 144 Score = 27.9 bits (59), Expect = 5.1 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 56 ANNDNFAQDITTDNQLNGNAENGGGD-SQDHNSAEAPGRDDDRK 184 +N+DN D +T N N N EN D S +NS + DD K Sbjct: 289 SNSDNSNTDNSTSN--NSNPENSTSDNSNSNNSNQDNSNSDDSK 330 >SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) Length = 337 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 176 DRKLFVGGLSWETTXKELRDHFGAYGE 256 DR +FVG L K L+ +F YGE Sbjct: 20 DRTVFVGNLPLTLKKKALKKYFSKYGE 46 >SB_56231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 383 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGG 199 ++D D D+ + G+ ++ GD D + + G DDD + GG Sbjct: 248 DDDGEVDDAGGDDGVGGDNDDDRGDDGDDDEDDDRGNDDDEDDWGGG 294 >SB_39141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 NN+N + +N N N N D D + + DDD Sbjct: 87 NNNNNNNNNNNNNNNNNNNNNNNNDDDDDDDDDDDDNDDD 126 >SB_23339| Best HMM Match : I-set (HMM E-Value=1.3e-07) Length = 423 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 NN N ++ DN + +A+N D D+N+ + G DD Sbjct: 14 NNGNDDENNYNDNHNDKDADNKNNDDGDNNNNDKCGYKDD 53 >SB_20262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGN--AENGGGDSQDHN 148 NNDN+ + DN N + NG DS D+N Sbjct: 192 NNDNYDNNDNNDNNDNNDNYDNNGNNDSNDNN 223 >SB_19847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 92 DNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 DN + + ++GGGD D N + G DDD Sbjct: 92 DNDDSNDVDDGGGDGDDDNDGD--GVDDD 118 >SB_15580| Best HMM Match : Pentapeptide (HMM E-Value=0.2) Length = 610 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 56 ANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEA 160 ANN N A + N N NA N ++ + N+A A Sbjct: 254 ANNANNANNANNANANNANANNANANNANANNANA 288 >SB_40510| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 734 Score = 27.1 bits (57), Expect = 8.9 Identities = 19/72 (26%), Positives = 36/72 (50%) Frame = -1 Query: 410 ALAFFGSTFLLLMVCSPAAMTLSIDSGALNTMKANPRDLPVFGSVFTLILSIHRMLQNDH 231 ALA + F M + +++ + A++ + +DLP+F V + +++H + D Sbjct: 495 ALASLEAIFNTFMFANNEHLSVLQTALAISRLIGGVKDLPLFFLVDSHRVALHLSVDKDP 554 Query: 230 GAPYXWSPSSAH 195 GA Y + S AH Sbjct: 555 GADYI-NASFAH 565 >SB_38604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 62 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRK 184 +DN D + N + +GG D D++S E DRK Sbjct: 117 DDNGEDDYDGNGDNNNDDNDGGDDDNDYDSNETMAFKKDRK 157 >SB_23644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDD 175 +NDN D N N+ +G +S D N + G D+ Sbjct: 19 DNDNSGDDNDNSGDDNDNSGDGNDNSGDGNDSNGDGNDN 57 >SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) Length = 508 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 68 NFAQDITTDNQLNGNAE-NGGGDSQDHNSAEAPGRDD 175 ++ D D+ NG+ + +GGGD D + ++ G DD Sbjct: 441 DYDSDGDGDDDDNGDGDVDGGGDGDDDDDSDGDGDDD 477 >SB_54036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 NN+N +I +N N N N ++ ++N+ DDD Sbjct: 64 NNNNNNNNIKNNNNNNNNNNNKNNNNNNNNNNNNDDDDDD 103 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 27.1 bits (57), Expect = 8.9 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 119 NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRD 235 NGG + D + A R++ +LFV GL E + +LR+ Sbjct: 603 NGGKSTDDASDAAYELRNEGVELFVVGLGDENSEAQLRE 641 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 27.1 bits (57), Expect = 8.9 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAE 157 N+D+ + DN + +A +GGGD+ D++ ++ Sbjct: 802 NDDDDDDNGDADNGRDNDAHDGGGDNSDYDGSD 834 >SB_25551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 62 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 +D+ D D+ + +GGGD D + G DDD Sbjct: 104 DDDGDDDDDDDDDDDDGGGDGGGDGDDDDDGNGDGGDDD 142 >SB_23204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 27.1 bits (57), Expect = 8.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 116 ENGGGDSQDHNSAEAPGRDDDRK 184 +N GGD D++ + DDD K Sbjct: 8 DNDGGDDDDNDDVDGDNNDDDHK 30 >SB_23116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 178 NNDN ++ +N + N +N D D N+ DDD Sbjct: 119 NNDNNNKNNNNNNDDDDNNKNDNDDDYDDNNNNNDDYDDD 158 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,279,213 Number of Sequences: 59808 Number of extensions: 315817 Number of successful extensions: 2433 Number of sequences better than 10.0: 75 Number of HSP's better than 10.0 without gapping: 1022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2236 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -