BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0718 (506 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 64 7e-11 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 64 7e-11 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 57 8e-09 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 56 2e-08 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 54 6e-08 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 54 6e-08 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 54 6e-08 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 51 4e-07 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 51 4e-07 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 50 1e-06 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 50 1e-06 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 50 1e-06 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 48 5e-06 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 48 5e-06 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 47 6e-06 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 37 3e-05 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 34 6e-05 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 43 1e-04 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 43 1e-04 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 41 4e-04 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 41 4e-04 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 41 6e-04 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 40 7e-04 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 39 0.002 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 39 0.002 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 39 0.002 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 39 0.002 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 39 0.002 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 31 0.003 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 38 0.004 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 30 0.005 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 37 0.007 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 37 0.007 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 37 0.007 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 36 0.012 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 36 0.012 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 36 0.016 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 36 0.016 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 36 0.016 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 36 0.016 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 36 0.016 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 36 0.021 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 36 0.021 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 35 0.027 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 35 0.027 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 35 0.027 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 35 0.027 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 35 0.027 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 35 0.027 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 35 0.027 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 35 0.027 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 35 0.036 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 35 0.036 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 35 0.036 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 35 0.036 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 35 0.036 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 35 0.036 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 35 0.036 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 35 0.036 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 34 0.048 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 34 0.063 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 34 0.063 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 34 0.063 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 34 0.063 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 33 0.084 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 33 0.084 At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein ... 33 0.084 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 33 0.084 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 33 0.084 At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein ... 33 0.11 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 33 0.11 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 33 0.11 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 33 0.11 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 32 0.26 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 32 0.26 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 32 0.26 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 32 0.26 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 31 0.34 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 31 0.34 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 31 0.34 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 31 0.34 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 31 0.34 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 31 0.34 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 31 0.34 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 31 0.34 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 31 0.45 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 31 0.45 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 31 0.45 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 31 0.45 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 31 0.59 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 31 0.59 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 30 0.78 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 30 0.78 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 30 0.78 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 30 0.78 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 30 0.78 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 30 0.78 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 30 0.78 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 30 0.78 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 30 0.78 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 30 0.78 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 30 0.78 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 30 0.78 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 30 0.78 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 30 0.78 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 30 0.78 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 30 0.78 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 30 1.0 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 30 1.0 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 30 1.0 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 30 1.0 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 30 1.0 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 30 1.0 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 30 1.0 At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing ... 29 1.4 At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing ... 29 1.4 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 1.4 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 29 1.4 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 29 1.4 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 29 1.4 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 29 1.4 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 29 1.8 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 29 1.8 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 29 1.8 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 29 1.8 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 29 1.8 At2g47390.1 68415.m05915 expressed protein 29 1.8 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 29 2.4 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 29 2.4 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 29 2.4 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 29 2.4 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 29 2.4 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 28 3.1 At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing ... 28 3.1 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 28 3.1 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 28 3.1 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 28 3.1 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 28 3.1 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 28 3.1 At3g49670.1 68416.m05429 leucine-rich repeat transmembrane prote... 28 3.1 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 28 3.1 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 28 3.1 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 28 3.1 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 28 4.2 At5g22830.1 68418.m02669 magnesium transporter CorA-like family ... 28 4.2 At5g09970.1 68418.m01152 cytochrome P450 family protein 28 4.2 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 27 5.5 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 27 5.5 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 27 5.5 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 27 5.5 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 27 5.5 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 27 5.5 At5g49760.1 68418.m06163 leucine-rich repeat family protein / pr... 27 7.3 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 27 7.3 At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing ... 27 7.3 At3g53160.1 68416.m05858 UDP-glucoronosyl/UDP-glucosyl transfera... 27 7.3 At1g09810.1 68414.m01101 expressed protein contains Pfam profile... 27 7.3 At5g26742.1 68418.m03161 DEAD box RNA helicase (RH3) nearly iden... 27 9.6 At5g18280.1 68418.m02149 apyrase (APY2) identical to apyrase GI:... 27 9.6 At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein ... 27 9.6 At2g33440.1 68415.m04099 splicing factor family protein similar ... 27 9.6 At1g11200.1 68414.m01283 expressed protein contains Pfam profile... 27 9.6 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 63.7 bits (148), Expect = 7e-11 Identities = 34/89 (38%), Positives = 54/89 (60%), Gaps = 11/89 (12%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--KARHG-------- 420 + D +TG+ RGF FI F P +DKV+ H IN K+V+ K+ K G Sbjct: 50 IMRDRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPKGAGGNQSKDIKT 108 Query: 421 -KIFVGGLSSEISDDEIRNFFSEFGTILE 504 KIFVGG+ S +++DE+++FF+++G ++E Sbjct: 109 KKIFVGGIPSTVTEDELKDFFAKYGNVVE 137 Score = 39.1 bits (87), Expect = 0.002 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 6/77 (7%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAAG------EHTINNKKVDPKKAKARHGKIFVGGL 441 D T RSRGF F++F + E +D++++ G + + KK +PKK+ R + Sbjct: 143 DHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKKSLNRSPPSYGSHP 202 Query: 442 SSEISDDEIRNFFSEFG 492 S+D ++ +G Sbjct: 203 RGRSSNDSYASYGGPYG 219 Score = 34.3 bits (75), Expect = 0.048 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +2 Query: 125 GGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 G S++ N G K+F+GGL +TT HFG YGE Sbjct: 2 GSRSRNDNFQSGDGASPG-KIFIGGLHKDTTNTVFNKHFGKYGE 44 Score = 30.3 bits (65), Expect = 0.78 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYG 253 +K+FVGG+ T EL+D F YG Sbjct: 109 KKIFVGGIPSTVTEDELKDFFAKYG 133 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 409 ARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 A GKIF+GGL + ++ F ++G I + Sbjct: 16 ASPGKIFIGGLHKDTTNTVFNKHFGKYGEITD 47 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 63.7 bits (148), Expect = 7e-11 Identities = 34/89 (38%), Positives = 54/89 (60%), Gaps = 11/89 (12%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--KARHG-------- 420 + D +TG+ RGF FI F P +DKV+ H IN K+V+ K+ K G Sbjct: 50 IMRDRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPKGAGGNQSKDIKT 108 Query: 421 -KIFVGGLSSEISDDEIRNFFSEFGTILE 504 KIFVGG+ S +++DE+++FF+++G ++E Sbjct: 109 KKIFVGGIPSTVTEDELKDFFAKYGNVVE 137 Score = 34.3 bits (75), Expect = 0.048 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +2 Query: 125 GGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 G S++ N G K+F+GGL +TT HFG YGE Sbjct: 2 GSRSRNDNFQSGDGASPG-KIFIGGLHKDTTNTVFNKHFGKYGE 44 Score = 33.9 bits (74), Expect = 0.063 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAAG 363 D T RSRGF F++F + E +D++++ G Sbjct: 143 DHETNRSRGFGFVIFDSEEVVDELLSKG 170 Score = 30.3 bits (65), Expect = 0.78 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYG 253 +K+FVGG+ T EL+D F YG Sbjct: 109 KKIFVGGIPSTVTEDELKDFFAKYG 133 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 409 ARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 A GKIF+GGL + ++ F ++G I + Sbjct: 16 ASPGKIFIGGLHKDTTNTVFNKHFGKYGEITD 47 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 56.8 bits (131), Expect = 8e-09 Identities = 34/95 (35%), Positives = 54/95 (56%), Gaps = 12/95 (12%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPK------------ 399 ++S+ + TD TG RGF F+ F +KV+ +H I+++KVD K Sbjct: 93 VDSV-IMTDRITGNPRGFGFVTFADSAVAEKVLEE-DHVIDDRKVDLKRTLPRGDKDTDI 150 Query: 400 KAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 KA ++ KIFVGGL + +DE++N+F +G I+E Sbjct: 151 KAVSKTRKIFVGGLPPLLEEDELKNYFCVYGDIIE 185 Score = 45.2 bits (102), Expect = 3e-05 Identities = 18/46 (39%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKAR 414 D +TGRSRGF F+ F+ +S+D++ + G+ H + +K+V+ K+A+ + Sbjct: 191 DHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPK 236 Score = 43.6 bits (98), Expect = 8e-05 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 5/62 (8%) Frame = +2 Query: 86 TTDNQLNGNA--ENGG---GDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAY 250 T D++ NG A + GG S DH + + KLFVGG+SWETT + ++FG + Sbjct: 31 TFDDRRNGGAAVDTGGIQMKHSVDHRHSSS-SMSSPGKLFVGGVSWETTAETFANYFGKF 89 Query: 251 GE 256 GE Sbjct: 90 GE 91 Score = 33.5 bits (73), Expect = 0.084 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +1 Query: 418 GKIFVGGLSSEISDDEIRNFFSEFGTILE 504 GK+FVGG+S E + + N+F +FG +++ Sbjct: 66 GKLFVGGVSWETTAETFANYFGKFGEVVD 94 Score = 27.5 bits (58), Expect = 5.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYGE 256 RK+FVGGL EL+++F YG+ Sbjct: 157 RKIFVGGLPPLLEEDELKNYFCVYGD 182 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 55.6 bits (128), Expect = 2e-08 Identities = 31/87 (35%), Positives = 45/87 (51%), Gaps = 9/87 (10%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHG---------K 423 + D TG+ RGF F+ + +DKV+ H I K+V+ K+ R K Sbjct: 73 IMKDRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPRGSMSSNDFKTKK 131 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTILE 504 IFVGG+ S + DDE + FF +FG + E Sbjct: 132 IFVGGIPSSVDDDEFKEFFMQFGELKE 158 Score = 42.3 bits (95), Expect = 2e-04 Identities = 24/60 (40%), Positives = 32/60 (53%) Frame = +2 Query: 77 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 +D D + + + E+ SQ H+ G D K+FVGGL+ ETT E HFG YGE Sbjct: 11 EDEIHDPKPSEDIEDDDDKSQPHSGG---GVDSAGKIFVGGLARETTSAEFLKHFGKYGE 67 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/49 (32%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH-TINNKKVDPKKAKAR 414 + D +TGRSRGF F+ +++ + +D ++A G ++ +V+ KKA+ + Sbjct: 161 IMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 30.7 bits (66), Expect = 0.59 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 418 GKIFVGGLSSEISDDEIRNFFSEFGTILE 504 GKIFVGGL+ E + E F ++G I + Sbjct: 42 GKIFVGGLARETTSAEFLKHFGKYGEITD 70 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 54.0 bits (124), Expect = 6e-08 Identities = 39/108 (36%), Positives = 58/108 (53%), Gaps = 25/108 (23%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR------- 414 +E++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 33 VEAV-IMRDRATGRARGFGFIVFADPCVSERVIM-DKHIIDGRTVEAKKAVPRDDQQVLK 90 Query: 415 ------------HG------KIFVGGLSSEISDDEIRNFFSEFGTILE 504 HG KIFVGGL S I+++E +N+F +FGTI + Sbjct: 91 RHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIAD 138 Score = 43.6 bits (98), Expect = 8e-05 Identities = 20/50 (40%), Positives = 30/50 (60%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 136 IADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 39.9 bits (89), Expect = 0.001 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 KLF+GG+SW+T + LRD+F YG+ Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGD 31 Score = 36.3 bits (80), Expect = 0.012 Identities = 11/29 (37%), Positives = 23/29 (79%) Frame = +1 Query: 418 GKIFVGGLSSEISDDEIRNFFSEFGTILE 504 GK+F+GG+S + ++ +R++FS +G ++E Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYGDVVE 34 Score = 27.5 bits (58), Expect = 5.5 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYG 253 +K+FVGGL T +E +++F +G Sbjct: 110 KKIFVGGLPSSITEEEFKNYFDQFG 134 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 54.0 bits (124), Expect = 6e-08 Identities = 39/108 (36%), Positives = 58/108 (53%), Gaps = 25/108 (23%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR------- 414 +E++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 33 VEAV-IMRDRATGRARGFGFIVFADPCVSERVIM-DKHIIDGRTVEAKKAVPRDDQQVLK 90 Query: 415 ------------HG------KIFVGGLSSEISDDEIRNFFSEFGTILE 504 HG KIFVGGL S I+++E +N+F +FGTI + Sbjct: 91 RHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIAD 138 Score = 43.6 bits (98), Expect = 8e-05 Identities = 20/50 (40%), Positives = 30/50 (60%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 136 IADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 39.9 bits (89), Expect = 0.001 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 KLF+GG+SW+T + LRD+F YG+ Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGD 31 Score = 36.3 bits (80), Expect = 0.012 Identities = 11/29 (37%), Positives = 23/29 (79%) Frame = +1 Query: 418 GKIFVGGLSSEISDDEIRNFFSEFGTILE 504 GK+F+GG+S + ++ +R++FS +G ++E Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYGDVVE 34 Score = 27.5 bits (58), Expect = 5.5 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYG 253 +K+FVGGL T +E +++F +G Sbjct: 110 KKIFVGGLPSSITEEEFKNYFDQFG 134 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 54.0 bits (124), Expect = 6e-08 Identities = 39/108 (36%), Positives = 58/108 (53%), Gaps = 25/108 (23%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR------- 414 +E++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 33 VEAV-IMRDRATGRARGFGFIVFADPCVSERVIM-DKHIIDGRTVEAKKAVPRDDQQVLK 90 Query: 415 ------------HG------KIFVGGLSSEISDDEIRNFFSEFGTILE 504 HG KIFVGGL S I+++E +N+F +FGTI + Sbjct: 91 RHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIAD 138 Score = 43.6 bits (98), Expect = 8e-05 Identities = 20/50 (40%), Positives = 30/50 (60%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 136 IADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 39.9 bits (89), Expect = 0.001 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 KLF+GG+SW+T + LRD+F YG+ Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGD 31 Score = 36.3 bits (80), Expect = 0.012 Identities = 11/29 (37%), Positives = 23/29 (79%) Frame = +1 Query: 418 GKIFVGGLSSEISDDEIRNFFSEFGTILE 504 GK+F+GG+S + ++ +R++FS +G ++E Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYGDVVE 34 Score = 27.5 bits (58), Expect = 5.5 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYG 253 +K+FVGGL T +E +++F +G Sbjct: 110 KKIFVGGLPSSITEEEFKNYFDQFG 134 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 51.2 bits (117), Expect = 4e-07 Identities = 35/104 (33%), Positives = 56/104 (53%), Gaps = 21/104 (20%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHG----- 420 +E++ +K D TGR+RGF F+VF P ++V+ +H I+ K V+ KKA R Sbjct: 33 LEAVIMK-DRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRDDHVVFN 90 Query: 421 ----------------KIFVGGLSSEISDDEIRNFFSEFGTILE 504 KIFVGGL+S +++ E + +F++FG I + Sbjct: 91 KSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITD 134 Score = 41.1 bits (92), Expect = 4e-04 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 KLF+GG+SWET+ LRD+F ++GE Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGE 31 Score = 40.7 bits (91), Expect = 6e-04 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 132 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 38.7 bits (86), Expect = 0.002 Identities = 14/28 (50%), Positives = 22/28 (78%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+F+GG+S E S+D +R++F FG +LE Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLE 34 Score = 32.7 bits (71), Expect = 0.15 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 158 APGRDDDRKLFVGGLSWETTXKELRDHFGAYG 253 +PG + +K+FVGGL+ T E + +F +G Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFKKYFAQFG 130 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 51.2 bits (117), Expect = 4e-07 Identities = 35/104 (33%), Positives = 56/104 (53%), Gaps = 21/104 (20%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHG----- 420 +E++ +K D TGR+RGF F+VF P ++V+ +H I+ K V+ KKA R Sbjct: 33 LEAVIMK-DRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRDDHVVFN 90 Query: 421 ----------------KIFVGGLSSEISDDEIRNFFSEFGTILE 504 KIFVGGL+S +++ E + +F++FG I + Sbjct: 91 KSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITD 134 Score = 41.1 bits (92), Expect = 4e-04 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 KLF+GG+SWET+ LRD+F ++GE Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGE 31 Score = 40.7 bits (91), Expect = 6e-04 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 132 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 38.7 bits (86), Expect = 0.002 Identities = 14/28 (50%), Positives = 22/28 (78%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+F+GG+S E S+D +R++F FG +LE Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLE 34 Score = 32.7 bits (71), Expect = 0.15 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 158 APGRDDDRKLFVGGLSWETTXKELRDHFGAYG 253 +PG + +K+FVGGL+ T E + +F +G Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFKKYFAQFG 130 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 49.6 bits (113), Expect = 1e-06 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 25/103 (24%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH----------- 417 V D TGR RGF F++F P +D+V+ +H+I+ ++VD K+A +R Sbjct: 37 VMRDKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKRAMSREEQQVSGRTGNL 95 Query: 418 --------------GKIFVGGLSSEISDDEIRNFFSEFGTILE 504 KIFVGGL ++D+E R +F +G + + Sbjct: 96 NTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFEVYGPVTD 138 Score = 44.0 bits (99), Expect = 6e-05 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +2 Query: 173 DDRKLFVGGLSWETTXKELRDHFGAYGE 256 D KLFVGG+SWET +LR+HF YGE Sbjct: 4 DQGKLFVGGISWETDEDKLREHFTNYGE 31 Score = 34.3 bits (75), Expect = 0.048 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +1 Query: 418 GKIFVGGLSSEISDDEIRNFFSEFGTI 498 GK+FVGG+S E +D++R F+ +G + Sbjct: 6 GKLFVGGISWETDEDKLREHFTNYGEV 32 Score = 30.7 bits (66), Expect = 0.59 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Frame = +2 Query: 77 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRD---DDRKLFVGGLSWETTXKELRDHFGA 247 +++ ++ + G + + N++ + G D +K+FVGGL T +E R +F Sbjct: 73 REVDVKRAMSREEQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFEV 132 Query: 248 YG 253 YG Sbjct: 133 YG 134 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 49.6 bits (113), Expect = 1e-06 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 23/103 (22%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---------- 405 IE++ +K D TGR+RGF F+VF P ++ +++ +H I+ + V+ KKA Sbjct: 33 IEAVILK-DRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPRDDQNMVN 90 Query: 406 -------------KARHGKIFVGGLSSEISDDEIRNFFSEFGT 495 R KIFVGGL S +++ + + +F +FGT Sbjct: 91 RSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGT 133 Score = 40.7 bits (91), Expect = 6e-04 Identities = 13/30 (43%), Positives = 24/30 (80%) Frame = +2 Query: 167 RDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 + D+ KLF+GG+SW+T + L+++F ++GE Sbjct: 2 QSDNGKLFIGGISWDTNEERLKEYFSSFGE 31 Score = 37.1 bits (82), Expect = 0.007 Identities = 11/30 (36%), Positives = 24/30 (80%) Frame = +1 Query: 415 HGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 +GK+F+GG+S + +++ ++ +FS FG ++E Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFGEVIE 34 Score = 31.5 bits (68), Expect = 0.34 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +2 Query: 110 NAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYG 253 N N S S PGR RK+FVGGL T + + +F +G Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYFEQFG 132 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 49.6 bits (113), Expect = 1e-06 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 23/103 (22%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---------- 405 IE++ +K D TGR+RGF F+VF P ++ +++ +H I+ + V+ KKA Sbjct: 33 IEAVILK-DRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPRDDQNMVN 90 Query: 406 -------------KARHGKIFVGGLSSEISDDEIRNFFSEFGT 495 R KIFVGGL S +++ + + +F +FGT Sbjct: 91 RSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGT 133 Score = 40.7 bits (91), Expect = 6e-04 Identities = 13/30 (43%), Positives = 24/30 (80%) Frame = +2 Query: 167 RDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 + D+ KLF+GG+SW+T + L+++F ++GE Sbjct: 2 QSDNGKLFIGGISWDTNEERLKEYFSSFGE 31 Score = 37.1 bits (82), Expect = 0.007 Identities = 11/30 (36%), Positives = 24/30 (80%) Frame = +1 Query: 415 HGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 +GK+F+GG+S + +++ ++ +FS FG ++E Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFGEVIE 34 Score = 31.5 bits (68), Expect = 0.34 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +2 Query: 110 NAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYG 253 N N S S PGR RK+FVGGL T + + +F +G Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYFEQFG 132 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 47.6 bits (108), Expect = 5e-06 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 9/92 (9%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH------ 417 +E V D +TGRSRGF ++ F + E + GEH + N+ ++ K A + Sbjct: 29 LEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL-KGEHFLGNRILEVKVATPKEEMRQPA 87 Query: 418 ---GKIFVGGLSSEISDDEIRNFFSEFGTILE 504 +IFV + S +S+ + R+ F +G I + Sbjct: 88 KKVTRIFVARIPSSVSESDFRSHFERYGEITD 119 Score = 32.3 bits (70), Expect = 0.19 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTI 498 KIFVG L E S D++R++F FG I Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFGHI 266 Score = 31.1 bits (67), Expect = 0.45 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 143 HNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYG 253 + E R K+FVG L E + +LRD+FG +G Sbjct: 228 YGRGEPTTRGIGNKIFVGRLPQEASVDDLRDYFGRFG 264 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 47.6 bits (108), Expect = 5e-06 Identities = 33/103 (32%), Positives = 48/103 (46%), Gaps = 25/103 (24%) Frame = +1 Query: 265 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH--------- 417 + V + TGR RGF F+ F P ID+V+ +H I+N+ VD K+A +R Sbjct: 35 VTVMREKATGRPRGFGFVAFSDPAVIDRVL-QDKHHIDNRDVDVKRAMSREEQSPAGRSG 93 Query: 418 ----------------GKIFVGGLSSEISDDEIRNFFSEFGTI 498 KIFVGGL ++ DE R +F +G + Sbjct: 94 TFNASRNFDSGANVRTKKIFVGGLPPALTSDEFRAYFETYGPV 136 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 + D T R RGF F+ F + +S+D V+ H +N K+V+ K+A Sbjct: 141 IMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRA 185 Score = 37.9 bits (84), Expect = 0.004 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 173 DDRKLFVGGLSWETTXKELRDHFGAYGE 256 D KLF+GG+SW+T LR++F +GE Sbjct: 4 DQGKLFIGGISWDTDENLLREYFSNFGE 31 Score = 35.5 bits (78), Expect = 0.021 Identities = 12/29 (41%), Positives = 22/29 (75%) Frame = +1 Query: 418 GKIFVGGLSSEISDDEIRNFFSEFGTILE 504 GK+F+GG+S + ++ +R +FS FG +L+ Sbjct: 6 GKLFIGGISWDTDENLLREYFSNFGEVLQ 34 Score = 27.5 bits (58), Expect = 5.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYG 253 +K+FVGGL T E R +F YG Sbjct: 110 KKIFVGGLPPALTSDEFRAYFETYG 134 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 47.2 bits (107), Expect = 6e-06 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 27/110 (24%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE----HTINNKKVDPKKAK----- 408 +E++ + D TGR+RGF FIVF P ++V+ T+ KK P+ + Sbjct: 42 VEAV-IMRDRTTGRARGFGFIVFADPSVAERVIMDKHIIDGRTVEAKKAVPRDDQQVLKR 100 Query: 409 ------------------ARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 AR KIFVGGL S I++ E +N+F +FGTI + Sbjct: 101 HASPMHLISPSHGGNGGGARTKKIFVGGLPSSITEAEFKNYFDQFGTIAD 150 Score = 45.2 bits (102), Expect = 3e-05 Identities = 22/50 (44%), Positives = 29/50 (58%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 I + V D NT R RGF FI F + ES+D V+ H +N K V+ K+A Sbjct: 148 IADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRA 197 Score = 39.5 bits (88), Expect = 0.001 Identities = 13/25 (52%), Positives = 21/25 (84%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 KLF+GG+SW+T + L+++FG YG+ Sbjct: 16 KLFIGGISWDTDEERLQEYFGKYGD 40 Score = 32.7 bits (71), Expect = 0.15 Identities = 9/29 (31%), Positives = 22/29 (75%) Frame = +1 Query: 418 GKIFVGGLSSEISDDEIRNFFSEFGTILE 504 GK+F+GG+S + ++ ++ +F ++G ++E Sbjct: 15 GKLFIGGISWDTDEERLQEYFGKYGDLVE 43 Score = 26.6 bits (56), Expect = 9.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYG 253 +K+FVGGL T E +++F +G Sbjct: 122 KKIFVGGLPSSITEAEFKNYFDQFG 146 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 36.7 bits (81), Expect = 0.009 Identities = 12/28 (42%), Positives = 22/28 (78%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGG++ E S++ ++ +FS +G +LE Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYGAVLE 34 Score = 35.5 bits (78), Expect(2) = 3e-05 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 409 ARHGKIFVGGLSSEISDDEIRNFFSEFG 492 +R KIFVGGLSS +++E +++F FG Sbjct: 117 SRTKKIFVGGLSSNTTEEEFKSYFERFG 144 Score = 32.3 bits (70), Expect = 0.19 Identities = 15/29 (51%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +2 Query: 170 DDDR-KLFVGGLSWETTXKELRDHFGAYG 253 D DR KLFVGG++ ET+ + L+ +F YG Sbjct: 2 DYDRYKLFVGGIAKETSEEALKQYFSRYG 30 Score = 31.1 bits (67), Expect = 0.45 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYG 253 +K+FVGGLS TT +E + +F +G Sbjct: 120 KKIFVGGLSSNTTEEEFKSYFERFG 144 Score = 29.1 bits (62), Expect(2) = 3e-05 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +1 Query: 289 TGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 417 TG+ RGF F+ F + K + H I K VD +KA +H Sbjct: 43 TGKPRGFGFVRFANDCDVVKAL-RDTHFILGKPVDVRKAIRKH 84 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 34.3 bits (75), Expect(2) = 6e-05 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = +1 Query: 337 SIDKVMAAGEHTINNKKV--DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 501 S V+ AG H N ++ + IFVGG+ ++ D+++R FS+FG ++ Sbjct: 292 SSQAVILAGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGEVV 348 Score = 29.1 bits (62), Expect(2) = 6e-05 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVF 324 ++S V D NTGRS+G+ F+ F Sbjct: 229 VKSAKVVIDSNTGRSKGYGFVRF 251 Score = 28.7 bits (61), Expect = 2.4 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +2 Query: 119 NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 +G S + S ++ G + +FVGG+ + ++LR F +GE Sbjct: 302 HGSNGSMGYGS-QSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGE 346 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 43.2 bits (97), Expect = 1e-04 Identities = 25/89 (28%), Positives = 47/89 (52%), Gaps = 8/89 (8%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVDPKKAKA 411 ++ +N+ D T SRG F++ + E DK++ A G +++ K + + Sbjct: 44 VDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYADGELER 103 Query: 412 RHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 K+FVG L +S+ E+++ FS++GTI Sbjct: 104 LEHKLFVGMLPKNVSEAEVQSLFSKYGTI 132 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 43.2 bits (97), Expect = 1e-04 Identities = 25/89 (28%), Positives = 47/89 (52%), Gaps = 8/89 (8%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVDPKKAKA 411 ++ +N+ D T SRG F++ + E DK++ A G +++ K + + Sbjct: 44 VDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYADGELER 103 Query: 412 RHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 K+FVG L +S+ E+++ FS++GTI Sbjct: 104 LEHKLFVGMLPKNVSEAEVQSLFSKYGTI 132 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 41.1 bits (92), Expect = 4e-04 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = +1 Query: 415 HGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 H K+FVGGL+ E DE+R +F +FG ILE Sbjct: 16 HTKVFVGGLAWETPTDEMRRYFDQFGEILE 45 Score = 36.7 bits (81), Expect = 0.009 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGL+WET E+R +F +GE Sbjct: 18 KVFVGGLAWETPTDEMRRYFDQFGE 42 Score = 31.5 bits (68), Expect = 0.34 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 277 TDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 TD TG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 50 TDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKAN 88 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 41.1 bits (92), Expect = 4e-04 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 12/93 (12%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----DPKKAKARHG 420 + +N+ + T RG F+ E DKV+ ++ +NKK P + K G Sbjct: 38 VNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQVKYADG 93 Query: 421 -------KIFVGGLSSEISDDEIRNFFSEFGTI 498 K+FVG L +S+ E+++ FSE+GTI Sbjct: 94 ELERLEHKLFVGMLPKNVSETEVQSLFSEYGTI 126 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 40.7 bits (91), Expect = 6e-04 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 59 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 108 Score = 37.5 bits (83), Expect = 0.005 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +1 Query: 346 KVMAAGEHTINNKK---VDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 K + +H + NK + + KIFVGGL+S +++ E + +F++FG I + Sbjct: 6 KAVPRDDHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITD 61 Score = 32.7 bits (71), Expect = 0.15 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 158 APGRDDDRKLFVGGLSWETTXKELRDHFGAYG 253 +PG + +K+FVGGL+ T E + +F +G Sbjct: 26 SPGPSNSKKIFVGGLASSVTEAEFKKYFAQFG 57 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 40.3 bits (90), Expect = 7e-04 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGL+WET + LR HF YGE Sbjct: 25 KVFVGGLAWETQSETLRQHFEQYGE 49 Score = 34.3 bits (75), Expect = 0.048 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 V D NTGRS+G+ F+ F+ PE+ + A I+ ++ + Sbjct: 55 VIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRAN 95 Score = 33.1 bits (72), Expect = 0.11 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGL+ E + +R F ++G ILE Sbjct: 25 KVFVGGLAWETQSETLRQHFEQYGEILE 52 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 39.1 bits (87), Expect = 0.002 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 12/91 (13%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV-----------DPK 399 I S V DP+ G+S+G+ F+ + E+ + +N+K+V DP Sbjct: 159 ILSCKVAVDPS-GQSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYVGPFVHKLQRDPS 217 Query: 400 KAKARHGKIFVGGLSSEISDDEIRNFFSEFG 492 K + ++V LS +SD+E+ F EFG Sbjct: 218 GEKVKFTNVYVKNLSESLSDEELNKVFGEFG 248 Score = 36.3 bits (80), Expect = 0.012 Identities = 23/90 (25%), Positives = 38/90 (42%), Gaps = 8/90 (8%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV-------DPKKAKA 411 + S+ V D T RS G+ ++ + P+ + + +N + + DP K+ Sbjct: 71 VVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNELNFMALNGRAIRVMYSVRDPSLRKS 130 Query: 412 RHGKIFVGGLSSEISDDEIRNFFSEFGTIL 501 G IF+ L I + FS FG IL Sbjct: 131 GVGNIFIKNLDKSIDHKALHETFSAFGPIL 160 Score = 30.7 bits (66), Expect = 0.59 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 406 KARHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 K++ ++V L ++DD++R F+ FGTI Sbjct: 323 KSQGSNLYVKNLDESVTDDKLREHFAPFGTI 353 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGL+ E DE+R +F +FG ILE Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEILE 45 Score = 36.3 bits (80), Expect = 0.012 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGL+WET E+R +F +GE Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGE 42 Score = 35.1 bits (77), Expect = 0.027 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +1 Query: 277 TDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 TD NTG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 50 TDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKAN 88 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGL+ E DE+R +F +FG ILE Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEILE 45 Score = 36.3 bits (80), Expect = 0.012 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGL+WET E+R +F +GE Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGE 42 Score = 35.1 bits (77), Expect = 0.027 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +1 Query: 277 TDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 TD NTG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 50 TDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKAN 88 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 38.7 bits (86), Expect = 0.002 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 8/90 (8%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT--------INNKKVDPKKAKA 411 + S+ V D N RS G+A+I F P + M A +T I DP + Sbjct: 75 VVSVRVCRDQNR-RSLGYAYINFSNPNDAYRAMEALNYTPLFDRPIRIMLSNRDPSTRLS 133 Query: 412 RHGKIFVGGLSSEISDDEIRNFFSEFGTIL 501 G IF+ L + I + + FS FGTIL Sbjct: 134 GKGNIFIKNLDASIDNKALFETFSSFGTIL 163 Score = 37.5 bits (83), Expect = 0.005 Identities = 34/102 (33%), Positives = 48/102 (47%), Gaps = 14/102 (13%) Frame = +1 Query: 235 SFWSIR*IESINVKTDPNTGRSRGFAFIVFKAPES----IDKV--MAAGE------HTIN 378 +F S I S V D TGRS+G+ F+ F+ ES IDK+ M + H I Sbjct: 155 TFSSFGTILSCKVAMDV-TGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFVGHFIR 213 Query: 379 NKKV--DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 ++ D R ++V L EI +DE+R F +FG I Sbjct: 214 RQERARDENTPTPRFTNVYVKNLPKEIGEDELRKTFGKFGVI 255 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGL+WET + LR HF YG+ Sbjct: 25 KVFVGGLAWETQSETLRRHFDQYGD 49 Score = 34.7 bits (76), Expect = 0.036 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPES 339 V TD NTGRS+G+ F+ F+ PE+ Sbjct: 55 VITDKNTGRSKGYGFVTFRDPEA 77 Score = 33.1 bits (72), Expect = 0.11 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGL+ E + +R F ++G ILE Sbjct: 25 KVFVGGLAWETQSETLRRHFDQYGDILE 52 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 31.1 bits (67), Expect(2) = 0.003 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHG 420 +E + V D TGRSRGF F+ S+ +V AA + N ++D + + G Sbjct: 117 VEMVEVIYDKITGRSRGFGFVTM---SSVSEVEAAAQQ-FNGYELDGRPLRVNAG 167 Score = 27.1 bits (57), Expect = 7.3 Identities = 10/46 (21%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKVDPKKAKAR 414 D ++GRS+GF F+ + + + + + + + ++ +++ +A+AR Sbjct: 238 DRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEAR 283 Score = 26.2 bits (55), Expect(2) = 0.003 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 +++VG LS + D + + FSE G ++E Sbjct: 205 RVYVGNLSWGVDDMALESLFSEQGKVVE 232 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 37.9 bits (84), Expect = 0.004 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 8/79 (10%) Frame = +1 Query: 289 TGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKV-------DPKKAKARHGKIFVGGLS 444 T RS G+A++ F PE + M + + I ++ + DP + G +F+ L Sbjct: 81 THRSLGYAYVNFANPEDASRAMESLNYAPIRDRPIRIMLSNRDPSTRLSGKGNVFIKNLD 140 Query: 445 SEISDDEIRNFFSEFGTIL 501 + I + + FS FGTIL Sbjct: 141 ASIDNKALYETFSSFGTIL 159 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 30.3 bits (65), Expect = 0.78 Identities = 20/90 (22%), Positives = 38/90 (42%), Gaps = 8/90 (8%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV--------DPKKAKA 411 + S+ V D T S G+ ++ + + +K M ++ N K+ D ++ Sbjct: 72 VVSVRVCRDAATNTSLGYGYVNYSNTDDAEKAMQKLNYSYLNGKMIRITYSSRDSSARRS 131 Query: 412 RHGKIFVGGLSSEISDDEIRNFFSEFGTIL 501 G +FV L + + + FS GTI+ Sbjct: 132 GVGNLFVKNLDKSVDNKTLHEAFSGCGTIV 161 Score = 29.5 bits (63), Expect(2) = 0.005 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTI 498 ++V L ++D+++R F+EFGTI Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGTI 354 Score = 27.1 bits (57), Expect(2) = 0.005 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 292 GRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK 402 G+SR F F+ F+ PE + + A +N KK D K+ Sbjct: 262 GKSRCFGFVNFENPEDAARAVEA----LNGKKFDDKE 294 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 37.1 bits (82), Expect = 0.007 Identities = 13/26 (50%), Positives = 21/26 (80%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTIL 501 IFVGGL + ++DDE+++ F +FG +L Sbjct: 262 IFVGGLDANVTDDELKSIFGQFGELL 287 Score = 30.3 bits (65), Expect = 0.78 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 137 QDHNSAEAPGRD-DDRKLFVGGLSWETTXKELRDHFGAYGE 256 Q+ A A D ++ +FVGGL T EL+ FG +GE Sbjct: 245 QNTQGANAGDNDPNNTTIFVGGLDANVTDDELKSIFGQFGE 285 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 37.1 bits (82), Expect = 0.007 Identities = 17/33 (51%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +1 Query: 409 ARHG-KIFVGGLSSEISDDEIRNFFSEFGTILE 504 A+ G +IFVGGLS E++D ++ FS FG IL+ Sbjct: 3 AKEGSRIFVGGLSPEVTDRDLERAFSRFGDILD 35 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 6/49 (12%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAA------GEHTINNKKVDPK 399 + + +TGRSRGF FI F ++D+ + G+ I+ + +PK Sbjct: 38 IMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEPK 86 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 ++FVGGLS E T ++L F +G+ Sbjct: 8 RIFVGGLSPEVTDRDLERAFSRFGD 32 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 37.1 bits (82), Expect = 0.007 Identities = 21/80 (26%), Positives = 44/80 (55%), Gaps = 10/80 (12%) Frame = +1 Query: 292 GRSRGFAFIVFK-------APESIDKVMAAGEHTINNK---KVDPKKAKARHGKIFVGGL 441 G+SRG+ F+ F+ A ++++ + A + K K D K + ++ +++ L Sbjct: 149 GKSRGYGFVQFEQEDAAHAAIQTLNSTIVADKEIYVGKFMKKTDRVKPEEKYTNLYMKNL 208 Query: 442 SSEISDDEIRNFFSEFGTIL 501 +++S+D +R F+EFG I+ Sbjct: 209 DADVSEDLLREKFAEFGKIV 228 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = +1 Query: 382 KKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 +K + +K A+ I+V ++ ++++E+R FS+ GTI Sbjct: 292 EKHEEQKMIAKVSNIYVKNVNVAVTEEELRKHFSQCGTI 330 Score = 27.5 bits (58), Expect = 5.5 Identities = 18/97 (18%), Positives = 45/97 (46%), Gaps = 8/97 (8%) Frame = +1 Query: 235 SFWSIR*IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-------- 390 +F + + S+ + D ++GRS + + F + + + + +++ N K+ Sbjct: 43 AFAEFKSLTSVRLCKDASSGRSLCYGYANFLSRQDANLAIEKKNNSLLNGKMIRVMWSVR 102 Query: 391 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 501 P + G +FV L +++ +++ F +FG I+ Sbjct: 103 APDARRNGVGNVFVKNLPESVTNAVLQDMFKKFGNIV 139 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 36.3 bits (80), Expect = 0.012 Identities = 12/26 (46%), Positives = 21/26 (80%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTIL 501 +FVGGL + ++DD ++N FS++G I+ Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIV 288 Score = 26.6 bits (56), Expect = 9.6 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 122 GGGDSQDHNSAEAPGRDDDRK--LFVGGLSWETTXKELRDHFGAYGE 256 G DS ++A +D +FVGGL T L++ F YGE Sbjct: 240 GQRDSYQSSAAGVTTDNDPNNTTVFVGGLDASVTDDHLKNVFSQYGE 286 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 36.3 bits (80), Expect = 0.012 Identities = 12/26 (46%), Positives = 21/26 (80%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTIL 501 +FVGGL + ++DD ++N FS++G I+ Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIV 288 Score = 26.6 bits (56), Expect = 9.6 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 122 GGGDSQDHNSAEAPGRDDDRK--LFVGGLSWETTXKELRDHFGAYGE 256 G DS ++A +D +FVGGL T L++ F YGE Sbjct: 240 GQRDSYQSSAAGVTTDNDPNNTTVFVGGLDASVTDDHLKNVFSQYGE 286 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 35.9 bits (79), Expect = 0.016 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 KLF+GGLSW + L+D F ++GE Sbjct: 42 KLFIGGLSWSVDEQSLKDAFSSFGE 66 Score = 31.9 bits (69), Expect = 0.26 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+F+GGLS + + +++ FS FG + E Sbjct: 42 KLFIGGLSWSVDEQSLKDAFSSFGEVAE 69 Score = 27.1 bits (57), Expect = 7.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 235 SFWSIR*IESINVKTDPNTGRSRGFAFIVF 324 +F S + + + D +GRSRGF F+ F Sbjct: 60 AFSSFGEVAEVRIAYDKGSGRSRGFGFVDF 89 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 35.9 bits (79), Expect = 0.016 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTIL 501 IFVGGL S ++D++++ FSEFG I+ Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIV 333 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 354 +++ V D NTGRS+G+ F+ F K M Sbjct: 226 VKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 258 Score = 27.9 bits (59), Expect = 4.2 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +2 Query: 89 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 T + NG + GG + G + +FVGGL T ++L+ F +GE Sbjct: 277 TPRKTNGYQQQGGY-MPSGAFTRSEGDTINTTIFVGGLDSSVTDEDLKQPFSEFGE 331 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 35.9 bits (79), Expect = 0.016 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGL+WET + ++ HF +GE Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGE 38 Score = 31.9 bits (69), Expect = 0.26 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGL+ E + ++ F +FG ILE Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILE 41 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 44 VITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 35.9 bits (79), Expect = 0.016 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGL+WET + ++ HF +GE Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGE 38 Score = 31.9 bits (69), Expect = 0.26 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGL+ E + ++ F +FG ILE Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILE 41 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 44 VITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 35.9 bits (79), Expect = 0.016 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGL+WET + ++ HF +GE Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGE 38 Score = 31.9 bits (69), Expect = 0.26 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGL+ E + ++ F +FG ILE Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILE 41 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 44 VITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 35.5 bits (78), Expect = 0.021 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGL+W+T + + DHF YG+ Sbjct: 18 KVFVGGLAWDTHKEAMYDHFIKYGD 42 Score = 27.1 bits (57), Expect = 7.3 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGL+ + + + + F ++G ILE Sbjct: 18 KVFVGGLAWDTHKEAMYDHFIKYGDILE 45 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 35.5 bits (78), Expect = 0.021 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 KIFVGGL+ E D +R +F +FG I+E Sbjct: 23 KIFVGGLAWETQRDTMRRYFEQFGEIVE 50 Score = 34.3 bits (75), Expect = 0.048 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGL+WET +R +F +GE Sbjct: 23 KIFVGGLAWETQRDTMRRYFEQFGE 47 Score = 33.5 bits (73), Expect = 0.084 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPES 339 +E++ V TD NTGRS+G+ F+ FK E+ Sbjct: 49 VEAV-VITDKNTGRSKGYGFVTFKEAEA 75 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 35.1 bits (77), Expect = 0.027 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 KLF+GGLSW T LRD F +G+ Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGD 60 Score = 29.9 bits (64), Expect = 1.0 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+F+GGLS D +R+ F+ FG +++ Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVD 63 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 35.1 bits (77), Expect = 0.027 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 KLF+GGLSW T LRD F +G+ Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGD 60 Score = 29.9 bits (64), Expect = 1.0 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+F+GGLS D +R+ F+ FG +++ Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVD 63 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 35.1 bits (77), Expect = 0.027 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +2 Query: 95 NQLNGNAENGGGDSQDHNSAEAPG--RDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 N+L+G G S + G R KLFVGGLSW T L+ F ++GE Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLKQAFTSFGE 60 Score = 30.3 bits (65), Expect = 0.78 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 235 SFWSIR*IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 354 +F S + V D TGRSRGF F+ F +S + + Sbjct: 54 AFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 29.9 bits (64), Expect = 1.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGLS D ++ F+ FG + E Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGEVTE 63 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 35.1 bits (77), Expect = 0.027 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +2 Query: 95 NQLNGNAENGGGDSQDHNSAEAPG--RDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 N+L+G G S + G R KLFVGGLSW T L+ F ++GE Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLKQAFTSFGE 60 Score = 30.3 bits (65), Expect = 0.78 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 235 SFWSIR*IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 354 +F S + V D TGRSRGF F+ F +S + + Sbjct: 54 AFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 29.9 bits (64), Expect = 1.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGLS D ++ F+ FG + E Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGEVTE 63 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 35.1 bits (77), Expect = 0.027 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = +2 Query: 131 DSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 DS+D + +E+P +KLF+ GLS+ T+ K LR F +GE Sbjct: 267 DSRDQDDSESPPVKT-KKLFITGLSFYTSEKTLRAAFEGFGE 307 Score = 27.5 bits (58), Expect = 5.5 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +1 Query: 334 ESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 ES++K + + D + + K+F+ GLS S+ +R F FG ++E Sbjct: 254 ESLNKDYEGDSTQDSRDQDDSESPPVKTKKLFITGLSFYTSEKTLRAAFEGFGELVE 310 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 35.1 bits (77), Expect = 0.027 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 155 EAPGRD-DDRKLFVGGLSWETTXKELRDHFGAYGE 256 EA RD RK+FV GL WETT + L F YGE Sbjct: 95 EAADRDVTHRKIFVYGLPWETTRETLVGVFEGYGE 129 Score = 30.3 bits (65), Expect = 0.78 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 384 IE V D TG+++GF F++FK + + + + I N+ Sbjct: 130 IEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 35.1 bits (77), Expect = 0.027 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 155 EAPGRD-DDRKLFVGGLSWETTXKELRDHFGAYGE 256 EA RD RK+FV GL WETT + L F YGE Sbjct: 95 EAADRDVTHRKIFVYGLPWETTRETLVGVFEGYGE 129 Score = 30.3 bits (65), Expect = 0.78 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 384 IE V D TG+++GF F++FK + + + + I N+ Sbjct: 130 IEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 35.1 bits (77), Expect = 0.027 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = +1 Query: 235 SFWSIR*IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 414 +F S IE +V D +TGR +G+ F++FK + + + E + N+ V A + Sbjct: 427 AFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIVVCNLASEK 486 Query: 415 HGK 423 GK Sbjct: 487 PGK 489 Score = 33.1 bits (72), Expect = 0.11 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 155 EAPGRD-DDRKLFVGGLSWETTXKELRDHFGAYGE 256 E+ RD R +FV G W+TT + L+ F +YGE Sbjct: 399 ESADRDIAQRNIFVRGFGWDTTQENLKTAFESYGE 433 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 34.7 bits (76), Expect = 0.036 Identities = 18/83 (21%), Positives = 35/83 (42%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVG 435 I + + D ++G S+G+AF+ FK + K + K ++F+G Sbjct: 142 IFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSLSETKNRLFIG 201 Query: 436 GLSSEISDDEIRNFFSEFGTILE 504 + ++DE R + G +E Sbjct: 202 NIPKNWTEDEFRKVIEDVGPGVE 224 Score = 30.7 bits (66), Expect = 0.59 Identities = 11/31 (35%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 415 HG-KIFVGGLSSEISDDEIRNFFSEFGTILE 504 HG ++F+GGL ++ ++++R+ E G I E Sbjct: 114 HGSEVFIGGLPRDVGEEDLRDLCEEIGEIFE 144 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +1 Query: 256 IESINVKTDP-NTGRSRGFAFIVF 324 +E+I + DP NT R+RGFAF+++ Sbjct: 223 VENIELIKDPTNTTRNRGFAFVLY 246 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 34.7 bits (76), Expect = 0.036 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 170 DDDRKLFVGGLSWETTXKELRDHFGAYG 253 D + + F+GGL+W T+ + LRD F YG Sbjct: 4 DPEYRCFIGGLAWTTSDRGLRDAFEKYG 31 Score = 32.3 bits (70), Expect = 0.19 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVDPKKAKARHG 420 V D +GRSRGF FI F +++D+ +AA ++ + + KA+ G Sbjct: 38 VVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQPHQG 88 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 34.7 bits (76), Expect = 0.036 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 155 EAPGRDDD-RKLFVGGLSWETTXKELRDHFGAYGE 256 E+ RD R +FV GL W+TT + L+ F YGE Sbjct: 154 ESADRDSSQRNIFVRGLGWDTTHENLKAAFEVYGE 188 Score = 31.1 bits (67), Expect = 0.45 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 390 I +V D +TGR++GF F++FK + + E + N+ V Sbjct: 189 ITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTV 233 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 34.7 bits (76), Expect = 0.036 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 176 DRKLFVGGLSWETTXKELRDHFGAYGE 256 + ++FVGGLSW+ T ++L F YG+ Sbjct: 11 ESRIFVGGLSWDVTERQLESTFDRYGK 37 Score = 29.9 bits (64), Expect = 1.0 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 +IFVGGLS ++++ ++ + F +G I E Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKITE 40 Score = 27.5 bits (58), Expect = 5.5 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKARHG 420 I + +TGR RGF FI F D + + NK + KA+ + G Sbjct: 38 ITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVG 93 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 34.7 bits (76), Expect = 0.036 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 176 DRKLFVGGLSWETTXKELRDHFGAYGE 256 + ++FVGGLSW+ T ++L F YG+ Sbjct: 11 ESRIFVGGLSWDVTERQLESTFDRYGK 37 Score = 29.9 bits (64), Expect = 1.0 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 +IFVGGLS ++++ ++ + F +G I E Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKITE 40 Score = 27.5 bits (58), Expect = 5.5 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKARHG 420 I + +TGR RGF FI F D + + NK + KA+ + G Sbjct: 38 ITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVG 93 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 34.7 bits (76), Expect = 0.036 Identities = 13/26 (50%), Positives = 21/26 (80%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTIL 501 IFVGGL S ++D++++ F+EFG I+ Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFGEIV 331 Score = 34.3 bits (75), Expect = 0.048 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 14/93 (15%) Frame = +1 Query: 250 R*IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP----------- 396 R I S+ V + N G S G+ F+ F++ + DKV+ T P Sbjct: 127 REIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTG 186 Query: 397 KKAKARHG---KIFVGGLSSEISDDEIRNFFSE 486 +K +G IFVG LS ++SD+ + FSE Sbjct: 187 EKRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 354 +++ V D NTGRS+G+ F+ F K M Sbjct: 224 VKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 Score = 27.9 bits (59), Expect = 4.2 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 89 TDNQLNGNAENGGGDSQDHNSAEAPGRDD-DRKLFVGGLSWETTXKELRDHFGAYGE 256 T + NG + GG + + P D + +FVGGL T ++L+ F +GE Sbjct: 275 TPRKTNGYQQQGG--YMPNGTLTRPEGDIMNTTIFVGGLDSSVTDEDLKQPFNEFGE 329 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 34.7 bits (76), Expect = 0.036 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGL+ E +RN+F +FG I+E Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFGDIVE 35 Score = 34.3 bits (75), Expect = 0.048 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGL+WET LR++F +G+ Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFGD 32 Score = 31.9 bits (69), Expect = 0.26 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 +E++ V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 34 VEAV-VITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 34.7 bits (76), Expect = 0.036 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVGGL+ E +RN+F +FG I+E Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFGDIVE 35 Score = 34.3 bits (75), Expect = 0.048 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGL+WET LR++F +G+ Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFGD 32 Score = 31.9 bits (69), Expect = 0.26 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 +E++ V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 34 VEAV-VITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 34.3 bits (75), Expect = 0.048 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 14/93 (15%) Frame = +1 Query: 250 R*IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP----------- 396 R I S+ V + N G S G+ F+ F++ + DKV+ T P Sbjct: 127 REIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTG 186 Query: 397 KKAKARHG---KIFVGGLSSEISDDEIRNFFSE 486 +K +G IFVG LS ++SD+ + FSE Sbjct: 187 EKRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 354 +++ V D NTGRS+G+ F+ F K M Sbjct: 224 VKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 33.9 bits (74), Expect = 0.063 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 V D T RS+GF F+ F+ ES + HTI+ + V+ K A Sbjct: 40 VVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 170 DDDRKLFVGGLSWETTXKELRDHFGAYGE 256 D + K++V GL W T + L +F +GE Sbjct: 6 DRETKIYVAGLPWITRTEGLISYFERFGE 34 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.9 bits (74), Expect = 0.063 Identities = 15/57 (26%), Positives = 29/57 (50%) Frame = +1 Query: 334 ESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 E +++ GE + +K +A G+++VG L I+ E+ F E GT+++ Sbjct: 89 EEVEEEGDEGEEEVEEEK-QTTQASGEEGRLYVGNLPYTITSSELSQIFGEAGTVVD 144 Score = 33.5 bits (73), Expect = 0.084 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +1 Query: 286 NTGRSRGFAFIVFKAPESIDKVMA 357 NTGRSRGF FI F++ E++ +A Sbjct: 255 NTGRSRGFGFISFESAENVQSALA 278 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 170 DDDRKLFVGGLSWETTXKELRDHFG 244 D K++ G L W T + L+D FG Sbjct: 216 DSPHKVYAGNLGWNLTSQGLKDAFG 240 Score = 26.6 bits (56), Expect = 9.6 Identities = 17/73 (23%), Positives = 33/73 (45%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVG 435 + + + D T RSRGF F+ + E + M N+ ++ + K ++ G Sbjct: 142 VVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAM----QMFNSSQIGGRTVKVNFPEVPRG 197 Query: 436 GLSSEISDDEIRN 474 G +E+ +IR+ Sbjct: 198 G-ENEVMRTKIRD 209 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 33.9 bits (74), Expect = 0.063 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 19/102 (18%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV------------DPK 399 IE D +G+S+G+ FI+FK+ + + I + +P Sbjct: 154 IEDCKCVVDKVSGQSKGYGFILFKSRSGARNALKQPQKKIGTRMTACQLASIGPVQGNPV 213 Query: 400 KAKARH-------GKIFVGGLSSEISDDEIRNFFSEFGTILE 504 A A+H KI+V +S++I ++ FFS FG I E Sbjct: 214 VAPAQHFNPENVQRKIYVSNVSADIDPQKLLEFFSRFGEIEE 255 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYGE 256 RK+FV GL W+T L D F YGE Sbjct: 128 RKIFVHGLGWDTKADSLIDAFKQYGE 153 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 IE + D TGR +GFA V+++ ES K + T + KA Sbjct: 253 IEEGPLGLDKATGRPKGFALFVYRSLESAKKALEEPHKTFEGHVLHCHKA 302 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 33.9 bits (74), Expect = 0.063 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 21/102 (20%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----DPKKAKARHG 420 + +N+ + T RG F+ E DKV+ ++ +NKK P + K G Sbjct: 38 VNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQVKYADG 93 Query: 421 ----------------KIFVGGLSSEISDDEIRNFFSEFGTI 498 K+FVG L +S+ E+++ FSE+GTI Sbjct: 94 ELERLDVLDCSCNPEHKLFVGMLPKNVSETEVQSLFSEYGTI 135 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 33.5 bits (73), Expect = 0.084 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 357 + V TDP+TGRS+G+ F+ F ++ MA Sbjct: 143 VRGAKVVTDPSTGRSKGYGFVKFAEESERNRAMA 176 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 33.5 bits (73), Expect = 0.084 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 391 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 +P++ + GKIFVG L + I E FF +FG I Sbjct: 156 NPQQEFRQEGKIFVGNLPTWIKKPEFEEFFRQFGPI 191 >At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 483 Score = 33.5 bits (73), Expect = 0.084 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +2 Query: 128 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 G + + + E+P R L+VGGL+ +++RD F A+GE Sbjct: 211 GKAGEMGTLESPEDQSIRTLYVGGLNSRVLEQDIRDQFYAHGE 253 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 33.5 bits (73), Expect = 0.084 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 414 D TGRSRGFAF+ F + E M ++ +++ A R Sbjct: 68 DRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATER 112 Score = 31.1 bits (67), Expect = 0.45 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGG+S+ T LR+ F YGE Sbjct: 35 KIFVGGISYSTDEFGLREAFSKYGE 59 Score = 28.7 bits (61), Expect = 2.4 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 KIFVGG+S + +R FS++G +++ Sbjct: 35 KIFVGGISYSTDEFGLREAFSKYGEVVD 62 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 33.5 bits (73), Expect = 0.084 Identities = 15/48 (31%), Positives = 29/48 (60%) Frame = +1 Query: 358 AGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 501 AG H N D ++ + IFVGGL ++++++++ FS+FG ++ Sbjct: 310 AGGHGGNGSMSD---GESNNSTIFVGGLDADVTEEDLMQPFSDFGEVV 354 Score = 30.3 bits (65), Expect = 0.78 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = +2 Query: 98 QLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 Q NG+ N + + G ++ +FVGGL + T ++L F +GE Sbjct: 300 QQNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGE 352 Score = 27.5 bits (58), Expect = 5.5 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVF 324 ++ V D NTGRS+G+ F+ F Sbjct: 240 VKGAKVVIDSNTGRSKGYGFVRF 262 >At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 363 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 155 EAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 E P + + L+VGGL+ +++ DHF AYGE Sbjct: 217 EPPEDESIKTLYVGGLNSRIFEQDIHDHFYAYGE 250 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 33.1 bits (72), Expect = 0.11 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVG L+W TT +LR +F +G+ Sbjct: 13 KIFVGNLTWRTTADDLRRYFEQFGQ 37 Score = 31.5 bits (68), Expect = 0.34 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 KIFVG L+ + D++R +F +FG +++ Sbjct: 13 KIFVGNLTWRTTADDLRRYFEQFGQVVD 40 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +2 Query: 128 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 G + + + E+P + + L+VGGL+ +++RD F A+GE Sbjct: 211 GKAGEMGTLESPDDESIKTLYVGGLNSRILEQDIRDQFYAHGE 253 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 33.1 bits (72), Expect = 0.11 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI-NNKKVDPKKAKARHGK 423 + +++ DP T SRGF FI K+ ++ + + +H++ + + +KA+ R G+ Sbjct: 101 VTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKARRRRGR 157 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 146 NSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 + AE PG L+V GLS T ++L DHF G+ Sbjct: 68 SDAENPGNS----LYVTGLSHRVTERDLEDHFAKEGK 100 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 31.9 bits (69), Expect = 0.26 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = +1 Query: 325 KAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTILE 504 K ++ V A + K + + +F G LS +I+ +I NFF E G +++ Sbjct: 353 KKDSDVEMVDAEQKSNAKQPKTPTNQTQGGSKTLFAGNLSYQIARSDIENFFKEAGEVVD 412 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFI 318 + ++V TD TG SRGFA+I Sbjct: 509 VTRVHVPTDRETGASRGFAYI 529 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 31.9 bits (69), Expect = 0.26 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 357 ++++ V TDP T +G AF+ F ES+ K +A Sbjct: 471 VQNVIVVTDPVTRHPKGTAFVTFATKESVGKAVA 504 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 31.9 bits (69), Expect = 0.26 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKAR 414 D TGRSRGF F+ FK +++ D + ++ + + +A++R Sbjct: 42 DRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSR 87 Score = 30.7 bits (66), Expect = 0.59 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 170 DDDRKLFVGGLSWETTXKELRDHFGAYGE 256 D + + FVGGL+W T + L F YG+ Sbjct: 5 DVEYRCFVGGLAWATDDRALETAFAQYGD 33 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 31.9 bits (69), Expect = 0.26 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKAR 414 D TGRSRGF F+ FK +++ D + ++ + + +A++R Sbjct: 42 DRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSR 87 Score = 30.7 bits (66), Expect = 0.59 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 170 DDDRKLFVGGLSWETTXKELRDHFGAYGE 256 D + + FVGGL+W T + L F YG+ Sbjct: 5 DVEYRCFVGGLAWATDDRALETAFAQYGD 33 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 31.5 bits (68), Expect = 0.34 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +2 Query: 98 QLNGNAENGGGDSQDHN---SAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYG 253 ++ AE G SQD + SA D R ++VG + + T +E++ HF + G Sbjct: 73 EMQAKAEKDMGASQDPSGGVSAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCG 127 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 31.5 bits (68), Expect = 0.34 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +2 Query: 104 NGNAENGGGDSQDHNSAEAPGRD--DDRKLFVGGLSWETTXKELRDHFGAYGE 256 +G+A GD + ++A D D +LFV L + T +EL +HF +G+ Sbjct: 234 DGDAMEVEGDGKVAQESKAVSDDVLDTGRLFVRNLPYTATEEELMEHFSTFGK 286 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 31.5 bits (68), Expect = 0.34 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYGE 256 RK+FV GL W+T + L + F YGE Sbjct: 140 RKIFVHGLGWDTKTETLIEAFKQYGE 165 Score = 27.9 bits (59), Expect = 4.2 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 IE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 271 IEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 27.1 bits (57), Expect = 7.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 KI+V + +E+ ++ FFS+FG I E Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEE 273 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 31.5 bits (68), Expect = 0.34 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYGE 256 RK+FV GL W+T + L + F YGE Sbjct: 140 RKIFVHGLGWDTKTETLIEAFKQYGE 165 Score = 27.9 bits (59), Expect = 4.2 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 IE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 271 IEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 27.1 bits (57), Expect = 7.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 KI+V + +E+ ++ FFS+FG I E Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEE 273 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 31.5 bits (68), Expect = 0.34 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYGE 256 RK+FV GL W+T + L + F YGE Sbjct: 140 RKIFVHGLGWDTKTETLIEAFKQYGE 165 Score = 27.9 bits (59), Expect = 4.2 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 IE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 271 IEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 27.1 bits (57), Expect = 7.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 KI+V + +E+ ++ FFS+FG I E Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEE 273 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 31.5 bits (68), Expect = 0.34 Identities = 11/28 (39%), Positives = 21/28 (75%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K++VGG+ + ++DEIR++F G I++ Sbjct: 162 KLYVGGIPYQSTEDEIRSYFRSCGVIIK 189 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYG 253 KL+VGG+ +++T E+R +F + G Sbjct: 162 KLYVGGIPYQSTEDEIRSYFRSCG 185 Score = 27.1 bits (57), Expect = 7.3 Identities = 8/24 (33%), Positives = 17/24 (70%) Frame = +2 Query: 170 DDDRKLFVGGLSWETTXKELRDHF 241 D ++++G L+W+TT +++R F Sbjct: 259 DGYNRVYIGNLAWDTTERDIRKLF 282 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 31.5 bits (68), Expect = 0.34 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 201 DKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 31.1 bits (67), Expect = 0.45 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYGE 256 RKLF+ GL+ +TT + LR F +YG+ Sbjct: 75 RKLFIRGLAADTTTEGLRSLFSSYGD 100 Score = 27.1 bits (57), Expect = 7.3 Identities = 19/75 (25%), Positives = 35/75 (46%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVG 435 +E V D TG+S+G+ F+ F +D + A + +KK+D + + Sbjct: 101 LEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQLAASGNQ 155 Query: 436 GLSSEISDDEIRNFF 480 G S+I+D +R + Sbjct: 156 GTGSQIADISMRKIY 170 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 31.5 bits (68), Expect = 0.34 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 405 D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 201 DKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 31.1 bits (67), Expect = 0.45 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 179 RKLFVGGLSWETTXKELRDHFGAYGE 256 RKLF+ GL+ +TT + LR F +YG+ Sbjct: 75 RKLFIRGLAADTTTEGLRSLFSSYGD 100 Score = 27.1 bits (57), Expect = 7.3 Identities = 19/75 (25%), Positives = 35/75 (46%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVG 435 +E V D TG+S+G+ F+ F +D + A + +KK+D + + Sbjct: 101 LEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQLAASGNQ 155 Query: 436 GLSSEISDDEIRNFF 480 G S+I+D +R + Sbjct: 156 GTGSQIADISMRKIY 170 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 31.1 bits (67), Expect = 0.45 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAK 408 IE++ V DP+ +G A+++FK E+ + V+ G + +++ + K Sbjct: 313 IEAVRVIRDPHLNIGKGIAYVLFKTREAANLVLKKGYLKLRERELRISRVK 363 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 31.1 bits (67), Expect = 0.45 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVDPKKA 405 + S V P T +S GF F+ F + E ++ ++A + +K+ KA Sbjct: 203 VVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA 253 Score = 27.5 bits (58), Expect = 5.5 Identities = 23/103 (22%), Positives = 45/103 (43%), Gaps = 21/103 (20%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKV-------------D 393 +E + V D +GRSR F F K+ E + V+ +T+ +++ D Sbjct: 102 VEKVQVMYDKYSGRSRRFGFATMKSVEDANAVVEKLNGNTVEGREIKVNITEKPIASSPD 161 Query: 394 PKKAKARHG-------KIFVGGLSSEISDDEIRNFFSEFGTIL 501 ++ K++VG L+ ++ + + N FSE G ++ Sbjct: 162 LSVLQSEDSAFVDSPYKVYVGNLAKTVTKEMLENLFSEKGKVV 204 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 31.1 bits (67), Expect = 0.45 Identities = 15/66 (22%), Positives = 31/66 (46%) Frame = +1 Query: 304 GFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFS 483 G I + I V+ + + ++ P + K++V GLS ++D +R+ F Sbjct: 39 GTGVISARRRRDIGGVLISSCLSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFE 98 Query: 484 EFGTIL 501 +FG ++ Sbjct: 99 QFGNLI 104 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYG 253 KL+V GLS+ TT LRD F +G Sbjct: 78 KLYVSGLSFRTTEDTLRDTFEQFG 101 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 31.1 bits (67), Expect = 0.45 Identities = 26/93 (27%), Positives = 40/93 (43%), Gaps = 12/93 (12%) Frame = +1 Query: 259 ESINVKTDPNTGRSRGFAFIVFKAPE-------SIDKVMAAGEHTINNKKVDPKKAK--- 408 E + V + +TG+SRGFAF+ E ++D G N PK K Sbjct: 112 ELVEVLYNRDTGQSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFADKPKPNKEPL 171 Query: 409 --ARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 501 K+FVG LS ++ + + F E G ++ Sbjct: 172 YPETEHKLFVGNLSWTVTSESLAGAFRECGDVV 204 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 170 DDDRKLFVGGLSWETTXKELRDHFGAYGE 256 + + KLFVG LSW T + L F G+ Sbjct: 174 ETEHKLFVGNLSWTVTSESLAGAFRECGD 202 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 30.7 bits (66), Expect = 0.59 Identities = 21/97 (21%), Positives = 41/97 (42%), Gaps = 14/97 (14%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVDPKKAKARHGK--- 423 +E V + +T +SRGF F+ E +K + +N +++ +A R + Sbjct: 139 VEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPRGSRPER 198 Query: 424 ----------IFVGGLSSEISDDEIRNFFSEFGTILE 504 I+VG L ++ + FSE G +++ Sbjct: 199 QPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHGKVVD 235 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAA 360 V +D TGRSRGF F+ ++ +AA Sbjct: 238 VVSDRETGRSRGFGFVQMSNENEVNVAIAA 267 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 30.7 bits (66), Expect = 0.59 Identities = 32/105 (30%), Positives = 46/105 (43%), Gaps = 25/105 (23%) Frame = +1 Query: 262 SINVKTDPNTGRSRGFAFIVFK-------APESIDKVMAAGEH------------TINNK 384 S+ V +P TG SRG ++ A S+D G T N Sbjct: 136 SVEVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVRYSVDMNPGTRRNP 195 Query: 385 KV---DPKKA---KARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 501 +V PKK +++H K++VG L D +RN FS+FGTI+ Sbjct: 196 EVLNSTPKKILMYESQH-KVYVGNLPWFTQPDGLRNHFSKFGTIV 239 Score = 29.9 bits (64), Expect = 1.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 170 DDDRKLFVGGLSWETTXKELRDHFGAYG 253 + K++VG L W T LR+HF +G Sbjct: 209 ESQHKVYVGNLPWFTQPDGLRNHFSKFG 236 Score = 27.5 bits (58), Expect = 5.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 357 I S V D TGR+R FAF+ F + E D ++ Sbjct: 238 IVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALS 271 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 30.3 bits (65), Expect = 0.78 Identities = 8/28 (28%), Positives = 21/28 (75%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+F+GG++ + +D +R F+++G +++ Sbjct: 41 KLFIGGMAYSMDEDSLREAFTKYGEVVD 68 Score = 29.9 bits (64), Expect = 1.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAA 360 D TGRSRGF F+ F + E+ + A Sbjct: 74 DRETGRSRGFGFVTFTSSEAASSAIQA 100 Score = 28.7 bits (61), Expect = 2.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 KLF+GG+++ LR+ F YGE Sbjct: 41 KLFIGGMAYSMDEDSLREAFTKYGE 65 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 30.3 bits (65), Expect = 0.78 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +1 Query: 235 SFWSIR*IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 360 +F S + V T+ TGRSRG+ F+ F + +S + ++A Sbjct: 50 AFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISA 91 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 30.3 bits (65), Expect = 0.78 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 + FVGGL+ +D++++ FS+FG +++ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVID 34 Score = 29.1 bits (62), Expect = 1.8 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 + FVGGL+W T ++L+ F +G+ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGD 31 Score = 27.1 bits (57), Expect = 7.3 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFK 327 D +GRSRGF F+ FK Sbjct: 40 DRESGRSRGFGFVTFK 55 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 30.3 bits (65), Expect = 0.78 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 + FVGGL+ +D++++ FS+FG +++ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVID 34 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 D +GRSRGF F+ FK +K M +N K++D Sbjct: 40 DRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 29.1 bits (62), Expect = 1.8 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 + FVGGL+W T ++L+ F +G+ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGD 31 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 30.3 bits (65), Expect = 0.78 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 + FVGGL+ +D++++ FS+FG +++ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVID 34 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 D +GRSRGF F+ FK +K M +N K++D Sbjct: 40 DRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 29.1 bits (62), Expect = 1.8 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 + FVGGL+W T ++L+ F +G+ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGD 31 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 30.3 bits (65), Expect = 0.78 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 + FVGGL+ +D++++ FS+FG +++ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVID 34 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 393 D +GRSRGF F+ FK +K M +N K++D Sbjct: 40 DRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 29.1 bits (62), Expect = 1.8 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 + FVGGL+W T ++L+ F +G+ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGD 31 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 30.3 bits (65), Expect = 0.78 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +1 Query: 343 DKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 DK + G + ++ D K + ++V L+ +DD+++N F E+G I Sbjct: 5 DKQVYVGPF-LRRQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFGEYGKI 55 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 406 KARHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 K + ++V L ISD++++ FS FGT+ Sbjct: 128 KFQSSNLYVKNLDPSISDEKLKEIFSPFGTV 158 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 357 + S V DPN G S+G F+ F PE + M+ Sbjct: 158 VTSSKVMRDPN-GTSKGSGFVAFATPEEATEAMS 190 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 30.3 bits (65), Expect = 0.78 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVG + +++EIR +F + G +LE Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLE 148 Score = 30.3 bits (65), Expect = 0.78 Identities = 18/84 (21%), Positives = 38/84 (45%), Gaps = 11/84 (13%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAA---------GEHTINNKKVDPKKAK--ARHGKI 426 D TG+ +G F+ + + D+ + A G + + D ++ + K+ Sbjct: 154 DKRTGQQQGCCFVKYATSKDADRAIRALHNQITLPGGTGPVQVRYADGERERIGTLEFKL 213 Query: 427 FVGGLSSEISDDEIRNFFSEFGTI 498 FVG L+ + ++ E+ F +FG + Sbjct: 214 FVGSLNKQATEKEVEEIFLQFGHV 237 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 30.3 bits (65), Expect = 0.78 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 K+FVG + +++EIR +F + G +LE Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLE 148 Score = 30.3 bits (65), Expect = 0.78 Identities = 18/84 (21%), Positives = 38/84 (45%), Gaps = 11/84 (13%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAA---------GEHTINNKKVDPKKAK--ARHGKI 426 D TG+ +G F+ + + D+ + A G + + D ++ + K+ Sbjct: 154 DKRTGQQQGCCFVKYATSKDADRAIRALHNQITLPGGTGPVQVRYADGERERIGTLEFKL 213 Query: 427 FVGGLSSEISDDEIRNFFSEFGTI 498 FVG L+ + ++ E+ F +FG + Sbjct: 214 FVGSLNKQATEKEVEEIFLQFGHV 237 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 30.3 bits (65), Expect = 0.78 Identities = 21/90 (23%), Positives = 40/90 (44%), Gaps = 12/90 (13%) Frame = +1 Query: 265 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-------GEHTINNKKVDPKKAKARHGK 423 ++ K G+S+GF F+ F +S +A G+ K ++ + A G Sbjct: 139 LSCKVVEENGQSKGFGFVQFDTEQSAVSARSALHGSMVYGKKLFVAKFINKDERAAMAGN 198 Query: 424 -----IFVGGLSSEISDDEIRNFFSEFGTI 498 ++V L ++DD + FS++GT+ Sbjct: 199 QDSTNVYVKNLIETVTDDCLHTLFSQYGTV 228 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 354 + S+ V D GRSRGF F+ F PE+ K M Sbjct: 228 VSSVVVMRD-GMGRSRGFGFVNFCNPENAKKAM 259 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 30.3 bits (65), Expect = 0.78 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 7/88 (7%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESID---KVMAA----GEHTINNKKVDPKKAKAR 414 + ++ V D T + + FI +++ E D KV+ G+ NK KK+ Sbjct: 51 VVNVYVPKDRVTNLHQNYGFIEYRSEEDADYAIKVLNMIKLHGKPIRVNKASQDKKSLDV 110 Query: 415 HGKIFVGGLSSEISDDEIRNFFSEFGTI 498 +F+G L ++ + + + FS FG I Sbjct: 111 GANLFIGNLDPDVDEKLLYDTFSAFGVI 138 Score = 30.3 bits (65), Expect = 0.78 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTINNK 384 + DP+TG SRGF FI + + E+ D + + G++ N + Sbjct: 144 IMRDPDTGNSRGFGFISYDSFEASDAAIESMTGQYLSNRQ 183 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 30.3 bits (65), Expect = 0.78 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 170 DDDRKLFVGGLSWETTXKELRDHFGAYGE 256 D++ + FVGGL+W T + + F +GE Sbjct: 41 DNEYRCFVGGLAWATDEQSIERCFNEFGE 69 Score = 28.7 bits (61), Expect = 2.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESI 342 D TGRS+GF F+ FK +S+ Sbjct: 78 DRETGRSKGFRFVTFKDEDSM 98 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 30.3 bits (65), Expect = 0.78 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 360 + N+ D TG S+G+AF V++ P D AA Sbjct: 401 LRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAA 435 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 30.3 bits (65), Expect = 0.78 Identities = 15/56 (26%), Positives = 25/56 (44%) Frame = +2 Query: 89 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 T NG GGG + + P R + ++ V GL + ++L+DH G+ Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHMRKGGD 144 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 30.3 bits (65), Expect = 0.78 Identities = 15/56 (26%), Positives = 25/56 (44%) Frame = +2 Query: 89 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 T NG GGG + + P R + ++ V GL + ++L+DH G+ Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHMRKGGD 144 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 30.3 bits (65), Expect = 0.78 Identities = 15/56 (26%), Positives = 25/56 (44%) Frame = +2 Query: 89 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 T NG GGG + + P R + ++ V GL + ++L+DH G+ Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHMRKGGD 144 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 29.9 bits (64), Expect = 1.0 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 8/65 (12%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVDPKKAKA 411 + + + D TG SRGFAF+ + KA E +D +V+ E T+ K P K Sbjct: 42 VVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYGPNAEKI 101 Query: 412 RHGKI 426 G++ Sbjct: 102 SKGRV 106 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 29.9 bits (64), Expect = 1.0 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 8/65 (12%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVDPKKAKA 411 + + + D TG SRGFAF+ + KA E +D +V+ E T+ K P K Sbjct: 42 VVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYGPNAEKI 101 Query: 412 RHGKI 426 G++ Sbjct: 102 SKGRV 106 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 29.9 bits (64), Expect = 1.0 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 361 GEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 GE NN + + + + VG +SS + D E++ F +FG I Sbjct: 198 GERGGNNSVGELNRGEIPSRTLLVGNISSNVEDYELKVLFEQFGDI 243 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 29.9 bits (64), Expect = 1.0 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI---NNKKVDPKKAKARHG 420 I+ + + D T SRGFAF+ F + E K + A T N K + AK+ HG Sbjct: 484 IKDLRLVRDKFTHVSRGFAFVHFYSVEDATKALEATNRTALERNGKILRVAYAKSVHG 541 Score = 28.7 bits (61), Expect = 2.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 369 + + V + N+G SRGFAFI F ++ +M EH Sbjct: 324 LHHVRVIREQNSGISRGFAFIDFPTVDAARTMMDRIEH 361 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 29.9 bits (64), Expect = 1.0 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +2 Query: 104 NGNAENGG--GDSQDHNSAEAPGRDDDR 181 +GN E G GD D++ + PG DDD+ Sbjct: 962 DGNHERGSESGDGDDYDDGDGPGSDDDK 989 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 29.9 bits (64), Expect = 1.0 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 235 SFWSIR*IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 357 +F S + V TD ++GRS+GF F+ + E +K A Sbjct: 53 AFASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKA 93 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 +LFV GLS TT ++L+D F ++G+ Sbjct: 35 RLFVSGLSRLTTNEKLQDAFASFGQ 59 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 29.9 bits (64), Expect = 1.0 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 391 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTIL 501 DP + G +FV L I + ++ + FS FG +L Sbjct: 22 DPSNRMSGRGNVFVKNLDESIDNKQLCDMFSAFGKVL 58 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 406 KARHG-KIFVGGLSSEISDDEIRNFFSEFGTI 498 K R G ++V L + + ++ FSEFGTI Sbjct: 218 KTRKGMNLYVKNLDDSVDNTKLEELFSEFGTI 249 >At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 817 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 423 ++SI + +TG+ RG A+ F E + +A KK+ ++ + GK Sbjct: 677 VDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKKGK 732 >At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 816 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 423 ++SI + +TG+ RG A+ F E + +A KK+ ++ + GK Sbjct: 677 VDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKKGK 732 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 62 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDR 181 NDN + +N N N NGGG ++ S P R+ DR Sbjct: 119 NDNNGNNNNGNNNDNNNQNNGGG--SNNRSPPPPSRNSDR 156 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 59 NNDNFAQDITTDNQLNGNAENGGGDSQDHNS 151 NN N D +N N N +N G+++D+N+ Sbjct: 76 NNGNNNNDNNNNNNGNNNNDNNNGNNKDNNN 106 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 29.5 bits (63), Expect = 1.4 Identities = 16/79 (20%), Positives = 34/79 (43%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVG 435 + + + +P T +S+G AF+ F E + + + + N K A + +FVG Sbjct: 240 VTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKELKSPMINGKKCGVTASQDNDTLFVG 299 Query: 436 GLSSEISDDEIRNFFSEFG 492 + + + +R +G Sbjct: 300 NICKIWTPEALREKLKHYG 318 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 29.5 bits (63), Expect = 1.4 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = +1 Query: 427 FVGGLSSEISDDEIRNFFSEFGTIL 501 +VG L S+ +++++N FS+FG ++ Sbjct: 11 YVGNLESDTEENDLKNAFSQFGDVI 35 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K+FVGGLS T + L++ FG++G+ Sbjct: 37 KIFVGGLSPSTDVELLKEAFGSFGK 61 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 KIFVGGLS + ++ F FG I++ Sbjct: 37 KIFVGGLSPSTDVELLKEAFGSFGKIVD 64 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +2 Query: 134 SQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 S ++++ AP R D ++ V GL + ++L+DH G+ Sbjct: 94 SSSYSASRAPSRRSDYRVLVTGLPPSASWQDLKDHMRKAGD 134 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 161 PGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 P + LFV GLS TT + LR F +GE Sbjct: 50 PQAEPSTNLFVSGLSKRTTSEGLRTAFAQFGE 81 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 29.1 bits (62), Expect = 1.8 Identities = 20/97 (20%), Positives = 41/97 (42%), Gaps = 14/97 (14%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVDPKKAKARHGK--- 423 +E V + T +SRGF F+ + + + + + +N + + KA R + Sbjct: 176 VEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPRGSRPER 235 Query: 424 ----------IFVGGLSSEISDDEIRNFFSEFGTILE 504 ++VG L ++ + + FSE G ++E Sbjct: 236 APRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVE 272 Score = 27.5 bits (58), Expect = 5.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDKVMAA 360 D TGRSRGF F+ + +++ ++A Sbjct: 278 DRETGRSRGFGFVTMSDVDELNEAISA 304 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 29.1 bits (62), Expect = 1.8 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 +++VG LS +DD +R FS +G +++ Sbjct: 4 RVYVGNLSPTTTDDMLREAFSGYGNVVD 31 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +2 Query: 107 GNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 G GGGD P R + ++ V GL + ++L+DH GE Sbjct: 98 GRGGRGGGDGGGRE--RGPSRRSEYRVVVSGLPSSASWQDLKDHMRKGGE 145 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +2 Query: 107 GNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 G GGGD P R + ++ V GL + ++L+DH GE Sbjct: 98 GRGGRGGGDGGGRE--RGPSRRSEYRVVVSGLPSSASWQDLKDHMRKGGE 145 >At2g47390.1 68415.m05915 expressed protein Length = 961 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 104 NGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRD 235 +G AE+GGG S SA A +DD G + E+RD Sbjct: 78 SGGAEDGGGTSNGSLSASATATEDDELAI--GTGYRLPPPEIRD 119 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 28.7 bits (61), Expect = 2.4 Identities = 8/26 (30%), Positives = 19/26 (73%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTIL 501 IFVG + +++D++++ F +FG ++ Sbjct: 280 IFVGAVDQSVTEDDLKSVFGQFGELV 305 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 28.7 bits (61), Expect = 2.4 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPES 339 I +N+ D TG+S+GFAF+ ++ S Sbjct: 62 IVDVNLIRDKGTGKSKGFAFLAYEDQRS 89 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 28.7 bits (61), Expect = 2.4 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 134 SQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYG 253 SQ+ + E + RKLFV L W + ++ + FG G Sbjct: 80 SQEEKTEETQNSNLKRKLFVFNLPWSMSVNDISELFGQCG 119 Score = 26.6 bits (56), Expect = 9.6 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +1 Query: 343 DKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 498 +K +A E T +K + + K+FV L +S ++I F + GT+ Sbjct: 70 EKETSADEETSQEEKTEETQNSNLKRKLFVFNLPWSMSVNDISELFGQCGTV 121 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 28.7 bits (61), Expect = 2.4 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTI 498 +++VG L +S+D++R F FG++ Sbjct: 286 RLYVGNLHINMSEDDLRKVFESFGSV 311 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 146 NSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 + AE PG L+V GLS T ++L DHF G+ Sbjct: 38 SDAENPGNS----LYVTGLSHRVTERDLEDHFAKEGK 70 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 390 + +++ DP T SRGF FI K+ ++ + + +H++ +V Sbjct: 71 VTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRV 115 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 170 DDDRKLFVGGLSWETTXKELRDHFGAYG 253 DD ++VGGL ++ T + +R F YG Sbjct: 4 DDGNSVYVGGLPYDITEEAVRRVFSIYG 31 >At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 130 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTI 498 +FV G S +S+ ++ FSEFG + Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQV 84 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTI 498 +FV G S +S+ ++ FSEFG + Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQV 84 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTI 498 +FV G S +S+ ++ FSEFG + Sbjct: 79 LFVKGFSDSVSEGRLKKVFSEFGQV 103 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVF 324 +E + + DP TG+ +GF FI F Sbjct: 291 VELVQLPLDPETGQCKGFGFIQF 313 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 176 DRKLFVGGLSWETTXKELRDHFGAYG 253 DRKL+VG L + + +LR F A+G Sbjct: 264 DRKLYVGNLHFNMSELQLRQIFEAFG 289 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESID 345 +E + V D TGRSRGF F+ ++ Sbjct: 125 VEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/46 (23%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 414 D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 283 DRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 328 Score = 26.6 bits (56), Expect = 9.6 Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +2 Query: 107 GNAENGGG------DSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 G+ +GGG S S G +L+VG LSW L + F G+ Sbjct: 219 GSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMALENLFNEQGK 274 Score = 26.6 bits (56), Expect = 9.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 +++VG LS + D + N F+E G ++E Sbjct: 250 RLYVGNLSWGVDDMALENLFNEQGKVVE 277 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESID 345 +E + V D TGRSRGF F+ ++ Sbjct: 125 VEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/46 (23%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 280 DPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 414 D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 291 DRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 336 Score = 26.6 bits (56), Expect = 9.6 Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +2 Query: 107 GNAENGGG------DSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFGAYGE 256 G+ +GGG S S G +L+VG LSW L + F G+ Sbjct: 227 GSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMALENLFNEQGK 282 Score = 26.6 bits (56), Expect = 9.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTILE 504 +++VG LS + D + N F+E G ++E Sbjct: 258 RLYVGNLSWGVDDMALENLFNEQGKVVE 285 >At3g49670.1 68416.m05429 leucine-rich repeat transmembrane protein kinase, putative CLAVATA1 receptor kinase, Arabidopsis thaliana, EMBL:ATU96879 Length = 1002 Score = 28.3 bits (60), Expect = 3.1 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -2 Query: 304 LVIXLCLDLSLH*YSLFTVCSKMITEL-LXCGLPAQPTNKKFSVVIASWGLST 149 L++ L L L LH FTV +K ITEL L + T + S ++ SW LST Sbjct: 3 LLLLLLLLLLLHISHSFTV-AKPITELHALLSLKSSFTIDEHSPLLTSWNLST 54 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 185 LFVGGLSWETTXKELRDHFGAYGE 256 L+VG L+ ETT +L + FG YG+ Sbjct: 20 LWVGSLTPETTESDLTELFGRYGD 43 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 424 IFVGGLSSEISDDEIRNFFSEFGTI 498 ++VGG+ +S D++ FS+FG I Sbjct: 252 LWVGGIGPNVSKDDLEEEFSKFGKI 276 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 28.3 bits (60), Expect = 3.1 Identities = 25/71 (35%), Positives = 31/71 (43%), Gaps = 3/71 (4%) Frame = -3 Query: 282 ICLYINTLYSPYAPKXXXXXXXXXXXXSPPTK---SFLSSSRPGASALL*SCESPPPFSA 112 I L+I T S +P S P+ S LS S P +L S PPP S+ Sbjct: 16 ILLFITTSSSSLSPSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSS 75 Query: 111 FPLSWLSVVIS 79 PLS LS +S Sbjct: 76 SPLSSLSPSLS 86 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 235 SFWSIR*IESINVKTDPNTGRSRGFAFIVFK 327 SF + V D TGRSRGF F+ F+ Sbjct: 167 SFSAFNSCSDARVMWDQKTGRSRGFGFVSFR 197 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 K++VGGL W T + L + F +GE Sbjct: 14 KIYVGGLPWTTRKEGLINFFKRFGE 38 Score = 27.5 bits (58), Expect = 5.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTIL 501 KI+VGGL + + NFF FG I+ Sbjct: 14 KIYVGGLPWTTRKEGLINFFKRFGEII 40 >At5g22830.1 68418.m02669 magnesium transporter CorA-like family protein weak similarity to SP|Q01926 RNA splicing protein MRS2, mitochondrial precursor {Saccharomyces cerevisiae}; contains Pfam profile PF01544: CorA-like Mg2+ transporter protein; supporting cDNA gi|12007446|gb|AF322255.1|AF322255 Length = 459 Score = 27.9 bits (59), Expect = 4.2 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 56 ANNDNFAQDITTDNQ-LNGNAENGGGDSQDHNSAEAPGRDDDRKL 187 A + A+D D + LN + ++ G DS + GRDD +K+ Sbjct: 65 AKSPTTAEDFVGDYESLNVSDDDDGSDSNSSDGDNGGGRDDSKKI 109 >At5g09970.1 68418.m01152 cytochrome P450 family protein Length = 536 Score = 27.9 bits (59), Expect = 4.2 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -1 Query: 305 PRDLPVFGSVFTLILSI-HRML 243 PR +PVFGS+FTL + HR L Sbjct: 73 PRGIPVFGSLFTLSRGLAHRTL 94 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 27.5 bits (58), Expect = 5.5 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 8/59 (13%) Frame = +1 Query: 256 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG--------EHTINNKKVDPKKAK 408 ++ + V + TG+S+ F FI F+ PE + +AAG EH + ++P+ K Sbjct: 86 VKRVRVARNKKTGKSKHFGFIQFEDPEVAE--IAAGAMNDYLLMEHMLKVHVIEPENVK 142 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 27.5 bits (58), Expect = 5.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 292 GRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 390 G SRGFAFI F++ +S + M + + +K+ Sbjct: 54 GESRGFAFIEFESADSAGRAMLHMDGRLIGQKI 86 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFK 327 V D TGRSRGF F+ F+ Sbjct: 175 VMWDQKTGRSRGFGFVSFR 193 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 27.5 bits (58), Expect = 5.5 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 155 EAPGRDD-DRKLFVGGLSWETTXKELRDHFGAYGE 256 E DD +R LF+ L ++ T +E++ F +GE Sbjct: 552 ETQDNDDFERTLFIRNLPFDVTKEEVKQRFTVFGE 586 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFK 327 V D TGRSRGF F+ F+ Sbjct: 183 VMWDQKTGRSRGFGFVSFR 201 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 271 VKTDPNTGRSRGFAFIVFK 327 V D TGRSRGF F+ F+ Sbjct: 170 VMWDQKTGRSRGFGFVSFR 188 >At5g49760.1 68418.m06163 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 953 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/33 (36%), Positives = 23/33 (69%), Gaps = 4/33 (12%) Frame = -1 Query: 395 GSTFLLLM----VCSPAAMTLSIDSGALNTMKA 309 G++ LL++ +CS +A+T +D+ ALN +K+ Sbjct: 6 GASLLLILFFFQICSVSALTNGLDASALNALKS 38 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 182 KLFVGGLSWETTXKELRDHFGAYGE 256 KLF+GGLS+ TT + L + F G+ Sbjct: 35 KLFIGGLSFCTTEQGLSEAFSKCGQ 59 >At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 399 Score = 27.1 bits (57), Expect = 7.3 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 295 RSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKARHGKI 426 + R F F+ F PE++ ++A G H + + +V K K + GK+ Sbjct: 191 QKRMFGFVTFMYPETVKSILAKGNPHFVCHSRVLVKPYKEK-GKV 234 >At3g53160.1 68416.m05858 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 490 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 259 LFTVCSKMITELLXCGLPAQPTNKKFSVVIASWG 158 L ++C+ + +L GL + +NK F VI WG Sbjct: 289 LGSLCNLPLAQLKELGLGLEASNKPFIWVIREWG 322 >At1g09810.1 68414.m01101 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 428 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +2 Query: 101 LNGNAENGGGDSQDHN-SAEAPGRDD 175 +NGN+ NG D +DHN E G D Sbjct: 113 INGNSNNGFWDQRDHNKKPERNGESD 138 >At5g26742.1 68418.m03161 DEAD box RNA helicase (RH3) nearly identical to RNA helicase [Arabidopsis thaliana] GI:3775987; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00098: Zinc knuckle Length = 747 Score = 26.6 bits (56), Expect = 9.6 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +2 Query: 92 DNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTXKELRDHFG 244 D+ +GGG S + + G DD +GG S ++ R+ FG Sbjct: 677 DDDRGSRRSSGGGSSWSRGGSSSRGSSDD--WLIGGRSSSSSRAPSRESFG 725 >At5g18280.1 68418.m02149 apyrase (APY2) identical to apyrase GI:6006801, GI:7672685 from [Arabidopsis thaliana] Length = 472 Score = 26.6 bits (56), Expect = 9.6 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 432 DKNLPMSCFSLLWVYFLVVDG 370 ++NLP C L++ Y L++DG Sbjct: 414 EENLPYLCMDLVYQYTLLIDG 434 >At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM), PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 540 Score = 26.6 bits (56), Expect = 9.6 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 295 RSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKARHGKI 426 + R F F+ F PE++ ++A G H + + +V K K + GK+ Sbjct: 294 QKRMFGFVTFVYPETVKSILAKGNPHFVCDSRVLVKPYKEK-GKV 337 >At2g33440.1 68415.m04099 splicing factor family protein similar to Splicing factor U2AF 65 kDa subunit (U2 snRNP auxiliary factor large subunit) {Homo sapiens} SP|P26368, {Mus musculus} SP|P26369; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 247 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 421 KIFVGGLSSEISDDEIRNFFSEFGTI 498 KIF+GG S IS + + S FG + Sbjct: 41 KIFIGGFSKAISSEMLMEIVSVFGPL 66 >At1g11200.1 68414.m01283 expressed protein contains Pfam profile PF03619: Domain of unknown function Length = 295 Score = 26.6 bits (56), Expect = 9.6 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 308 NPRDLPVFGSVFTLILSIHRMLQ 240 +P ++ V GSVF ++LS+H +Q Sbjct: 8 SPAEITVMGSVFCVLLSMHFTMQ 30 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,657,959 Number of Sequences: 28952 Number of extensions: 224499 Number of successful extensions: 1273 Number of sequences better than 10.0: 162 Number of HSP's better than 10.0 without gapping: 888 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1254 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -