BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0709 (615 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53977| Best HMM Match : AbfB (HMM E-Value=6e-08) 29 4.0 SB_27495| Best HMM Match : VWA (HMM E-Value=0) 28 5.2 >SB_53977| Best HMM Match : AbfB (HMM E-Value=6e-08) Length = 172 Score = 28.7 bits (61), Expect = 4.0 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -2 Query: 605 ASTTHKDKLKKHQTXCFLGKGIAIRIPGTPSDRSMP-PPYYLSHPTFVF 462 AS TH L KH + KG + GT S S+ P Y+L H + F Sbjct: 45 ASNTHGSLLSKHPGQFRIKKGGFLGKKGTVSIESLKNPGYFLRHKNYNF 93 >SB_27495| Best HMM Match : VWA (HMM E-Value=0) Length = 1064 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 155 RSSHAFWFNNTCFFSYLFAYNLRGYFQLRAD 247 R H+FWFN+ C YN +G+ + R++ Sbjct: 647 RKQHSFWFNDVC------GYNQKGFRKFRSE 671 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,929,139 Number of Sequences: 59808 Number of extensions: 380679 Number of successful extensions: 1075 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1075 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -