BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0709 (615 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g48050.2 68416.m05239 bromo-adjacent homology (BAH) domain-co... 29 2.4 At3g48050.1 68416.m05238 bromo-adjacent homology (BAH) domain-co... 29 2.4 At5g57960.1 68418.m07252 GTP-binding family protein similar to S... 27 9.9 >At3g48050.2 68416.m05239 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 1613 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -2 Query: 605 ASTTHKDKLKKHQTXCFLGKGIAIRIPGTPSDRSMPPPYYLSHP 474 AST H D + CF G I PG P + P PY + P Sbjct: 1486 ASTAHMDSSSSGRA-CFPGVNSQILGPGVPVPSNYPRPYIVGLP 1528 >At3g48050.1 68416.m05238 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 1613 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -2 Query: 605 ASTTHKDKLKKHQTXCFLGKGIAIRIPGTPSDRSMPPPYYLSHP 474 AST H D + CF G I PG P + P PY + P Sbjct: 1486 ASTAHMDSSSSGRA-CFPGVNSQILGPGVPVPSNYPRPYIVGLP 1528 >At5g57960.1 68418.m07252 GTP-binding family protein similar to SP|P25519 GTP-binding protein hflX {Escherichia coli} Length = 540 Score = 27.1 bits (57), Expect = 9.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 381 SKIPN*IVWSSVDRYSDP 328 S IP +VW+ VDR DP Sbjct: 420 SSIPKLVVWNKVDRVDDP 437 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,205,489 Number of Sequences: 28952 Number of extensions: 266641 Number of successful extensions: 634 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 634 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -