BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0708 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14680.1 68415.m01651 myosin heavy chain-related contains wea... 29 3.6 At3g58050.1 68416.m06471 expressed protein 28 4.7 At2g03220.1 68415.m00275 galactoside 2-alpha-L-fucosyltransferas... 28 4.7 >At2g14680.1 68415.m01651 myosin heavy chain-related contains weak similarity to Swiss-Prot:P35579 myosin heavy chain, nonmuscle type A (Cellular myosin heavy chain, type A, Nonmuscle myosin heavy chain-A, NMMHC-A) [Homo sapiens] Length = 629 Score = 28.7 bits (61), Expect = 3.6 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 2/79 (2%) Frame = +3 Query: 66 NHHDGRVF-LWCHPFIITSVRDMGSRGKSRIPTQQQARHSSSIVRSRCQTR*IKCDTGG- 239 N DGR+ +W +I + D SRG S + T+ + R + + IK + Sbjct: 470 NEKDGRLKNMWKKSYINRWI-DPSSRGGSHLNTEADYASNIEYSRMKVEYAAIKENLESM 528 Query: 240 SHVTTEAVKLPVAVLKVGE 296 H+TT +L +A+LKV E Sbjct: 529 GHLTTSIRRLRLALLKVKE 547 >At3g58050.1 68416.m06471 expressed protein Length = 1209 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 100 TLSSSHQSETWDPEAKAEYPRSN 168 T S H + W+P +YPRSN Sbjct: 834 TRDSLHSKQVWEPMEPKKYPRSN 856 >At2g03220.1 68415.m00275 galactoside 2-alpha-L-fucosyltransferase / xyloglucan alpha-(1,2)-fucosyltransferase (FUT1) (FT1) identical to SP|Q9SWH5 Galactoside 2-alpha-L-fucosyltransferase (EC 2.4.1.69) (Xyloglucan alpha-(1,2)-fucosyltransferase) (AtFUT1) {Arabidopsis thaliana} Length = 558 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/56 (28%), Positives = 20/56 (35%) Frame = -3 Query: 361 P*TRVNVTGASGNSMSRRTCLDSPTFNTATGSFTASVVTWLPPVSHLIHLVWHLDL 194 P R + G +MS C SP F T +P V H + W L L Sbjct: 502 PENRTTPDPSCGRAMSMEPCFHSPPFYDCKAKTGIDTGTLVPHVRHCEDISWGLKL 557 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,090,846 Number of Sequences: 28952 Number of extensions: 240048 Number of successful extensions: 621 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 621 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -