BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0704 (467 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3219| Best HMM Match : Ribosomal_L31 (HMM E-Value=1.7) 29 1.5 >SB_3219| Best HMM Match : Ribosomal_L31 (HMM E-Value=1.7) Length = 528 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = +3 Query: 249 GENFASAHRMLCISLKTRMQKTVKASSRHAEDWSQAPVFVRRQGTSAQLEPLCV 410 G NF R L L+ R + S H + W + ++ +GT+ L LC+ Sbjct: 75 GNNFKGKQRNLATDLRVRYSE----SFNHGDSWFKRECDMKEKGTNKHLSRLCL 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,820,082 Number of Sequences: 59808 Number of extensions: 290103 Number of successful extensions: 666 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 969807871 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -