BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0697 (454 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 40 8e-04 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 37 0.007 At3g07250.1 68416.m00863 nuclear transport factor 2 (NTF2) famil... 36 0.010 At5g58130.1 68418.m07273 RNA recognition motif (RRM)-containing ... 35 0.030 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 35 0.030 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 35 0.030 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 35 0.030 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 34 0.039 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 34 0.039 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 34 0.039 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 34 0.039 At5g37720.1 68418.m04541 RNA and export factor-binding protein, ... 34 0.052 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 34 0.052 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 34 0.052 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 33 0.068 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 33 0.090 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 33 0.090 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 33 0.090 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 33 0.090 At1g04440.1 68414.m00435 casein kinase, putative similar to case... 33 0.090 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 33 0.12 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 33 0.12 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 33 0.12 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 33 0.12 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 33 0.12 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 33 0.12 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 33 0.12 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 33 0.12 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 32 0.16 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 32 0.16 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 32 0.16 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 32 0.16 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 32 0.16 At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing ... 32 0.16 At2g47310.1 68415.m05906 flowering time control protein-related ... 32 0.16 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 32 0.16 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 32 0.16 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 32 0.16 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 32 0.16 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 32 0.16 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 32 0.21 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 32 0.21 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 32 0.21 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 31 0.28 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 31 0.28 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 31 0.28 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 31 0.28 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 31 0.28 At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-l... 31 0.28 At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-l... 31 0.28 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 31 0.36 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 31 0.36 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 31 0.36 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 31 0.36 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 31 0.36 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 31 0.48 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 31 0.48 At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing ... 31 0.48 At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing ... 31 0.48 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 31 0.48 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 31 0.48 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 31 0.48 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 31 0.48 At5g16260.1 68418.m01899 RNA recognition motif (RRM)-containing ... 30 0.64 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 30 0.64 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 30 0.64 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 30 0.64 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 30 0.64 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 30 0.64 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 30 0.84 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 30 0.84 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 30 0.84 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 30 0.84 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 30 0.84 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 30 0.84 At1g66260.1 68414.m07522 RNA and export factor-binding protein, ... 30 0.84 At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ... 30 0.84 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 29 1.1 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 29 1.1 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 29 1.1 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 29 1.1 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 29 1.1 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 29 1.1 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 29 1.1 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 29 1.5 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 29 1.5 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 29 1.5 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 29 1.5 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 29 1.5 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 29 1.5 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 29 1.9 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 29 1.9 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 29 1.9 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 29 1.9 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 28 2.6 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 28 2.6 At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing ... 28 2.6 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 28 2.6 At3g20410.1 68416.m02585 calmodulin-domain protein kinase isofor... 28 2.6 At5g53180.1 68418.m06611 polypyrimidine tract-binding protein, p... 28 3.4 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 28 3.4 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 28 3.4 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 27 4.5 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 27 4.5 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 27 4.5 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 27 4.5 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 27 4.5 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 27 5.9 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 27 5.9 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 27 5.9 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 27 5.9 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 27 5.9 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 27 5.9 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 27 5.9 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 27 5.9 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 27 5.9 At5g28390.1 68418.m03447 RNA recognition motif (RRM)-containing ... 27 7.8 At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing ... 27 7.8 At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein ... 27 7.8 At4g10610.1 68417.m01735 RNA-binding protein, putative 27 7.8 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 27 7.8 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 27 7.8 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 27 7.8 At2g21850.1 68415.m02596 DC1 domain-containing protein contains ... 27 7.8 At2g19180.1 68415.m02238 expressed protein 27 7.8 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 39.9 bits (89), Expect = 8e-04 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = +1 Query: 112 NGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIK 246 + S +++G L DVTEE++M+ FS FGE + + K GF++ Sbjct: 324 SNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQ 368 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 36.7 bits (81), Expect = 0.007 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEK 228 RL++ NL TEEE+M+ FS FG+ SE+ L +K Sbjct: 262 RLFVRNLPYTATEEELMEHFSTFGKISEVHLVLDK 296 Score = 33.9 bits (74), Expect = 0.052 Identities = 14/39 (35%), Positives = 26/39 (66%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 ++L++ N+ + T+ E+ ++FSPFG+ + L K KN G Sbjct: 669 TKLHVKNIAFEATKRELRQLFSPFGQIKSMRLPK-KNIG 706 Score = 27.5 bits (58), Expect = 4.5 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 354 VKNLPPFVSNELLYRSFEIFGKIERAYVKVDE 449 V+NLP + E L F FGKI ++ +D+ Sbjct: 265 VRNLPYTATEEELMEHFSTFGKISEVHLVLDK 296 >At3g07250.1 68416.m00863 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF02136: Nuclear transport factor 2 (NTF2) domain Length = 1294 Score = 36.3 bits (80), Expect = 0.010 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = +3 Query: 342 SAVRVKNLPPFVSNELLYRSFEIFGKIERAYVKVDER 452 +AV VKNLPP V+ + + +F+ FG I+R V+V R Sbjct: 1196 AAVHVKNLPPNVTTDWVENAFKQFGPIKRGGVQVSNR 1232 Score = 30.3 bits (65), Expect = 0.64 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +3 Query: 336 HNSAVRVKNLPPFVSNELLYRSFEIFGKIERAYVKV 443 +N+A+ VKNLP + L+ +F+ FG+I R V+V Sbjct: 1074 NNAAICVKNLPLNATIALVENAFKQFGEIRRGGVEV 1109 Score = 27.9 bits (59), Expect = 3.4 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +3 Query: 348 VRVKNLPPFVSNELLYRSFEIFGKIERAYVKV 443 +RVK+LPP + L+ F+ FG I++ ++V Sbjct: 552 IRVKDLPPNATVALVESVFKQFGPIKKGRIRV 583 >At5g58130.1 68418.m07273 RNA recognition motif (RRM)-containing protein Length = 748 Score = 34.7 bits (76), Expect = 0.030 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +1 Query: 100 EVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFG--EASELFLNKEKNFGFI 243 E G RL++G L V ++++K+FSP G +A E K ++F +I Sbjct: 3 EKSSGGGVRLHVGGLGESVGRDDLLKIFSPMGTVDAVEFVRTKGRSFAYI 52 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 34.7 bits (76), Expect = 0.030 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = +1 Query: 91 EQSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKN 231 E+ + + +YIGN++ TEE++ ++FS GE ++ + +KN Sbjct: 24 EEFDEALRASTTVYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLDKN 70 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 34.7 bits (76), Expect = 0.030 Identities = 13/44 (29%), Positives = 28/44 (63%) Frame = +1 Query: 106 KFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 K+ + +Y+G + D+TE +++ +FS +GE ++ L ++K G Sbjct: 31 KYKNSAYVYVGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTG 74 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 34.7 bits (76), Expect = 0.030 Identities = 16/49 (32%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Frame = +1 Query: 115 GRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKE-----KNFGFIK 246 G RLY+GNL +++E+++ K+F FG + + ++ K FGF++ Sbjct: 283 GARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRDETGLCKGFGFVQ 331 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 34.3 bits (75), Expect = 0.039 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 133 IGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIK 246 + NL +VTEEE+ K FS GE + + K +G+++ Sbjct: 241 VANLDQNVTEEELKKAFSQLGEVIYVKIPATKGYGYVQ 278 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 34.3 bits (75), Expect = 0.039 Identities = 19/45 (42%), Positives = 26/45 (57%) Frame = +1 Query: 112 NGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIK 246 +G +R+YIGNL D TE +I K+FS + + L K K G K Sbjct: 259 DGYNRVYIGNLAWDTTERDIRKLFSDC-VINSVRLGKNKETGEFK 302 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 34.3 bits (75), Expect = 0.039 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = +1 Query: 115 GRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKE----KNFGFIKMD*E 258 G + LY+ NL + +T + +MF PFG + +E K FGF++ D E Sbjct: 110 GFANLYVKNLDSSITSSCLERMFCPFGSILSCKVVEENGQSKGFGFVQFDTE 161 Score = 27.5 bits (58), Expect = 4.5 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFS 186 LY+G+L+ DVTE++++ FS Sbjct: 23 LYVGDLSPDVTEKDLIDKFS 42 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 34.3 bits (75), Expect = 0.039 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 6/51 (11%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 ++++G L+++ TEEE F FG +++ + N+ + FGF+ D E Sbjct: 121 KIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSE 171 Score = 31.9 bits (69), Expect = 0.21 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 6/49 (12%) Frame = +1 Query: 118 RSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEK------NFGFIK 246 R +L++G + + +EE + + FS +G E + KEK FGF++ Sbjct: 5 RYKLFVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVR 53 >At5g37720.1 68418.m04541 RNA and export factor-binding protein, putative transcriptional coactivator ALY, Mus musculus, EMBL:MMU89876 Length = 288 Score = 33.9 bits (74), Expect = 0.052 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKN 231 +RL++ NL VT E+I ++FS GE ++ +KN Sbjct: 93 TRLHVTNLDQGVTNEDIRELFSEIGEVERYAIHYDKN 129 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 33.9 bits (74), Expect = 0.052 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 +L+IG ++ D EE + + FS FGE E + K++ G Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTG 44 Score = 30.7 bits (66), Expect = 0.48 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 7/55 (12%) Frame = +1 Query: 115 GRSR-LYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 GR+R +++G L + VTE + F FG +++ + + + FGFI D E Sbjct: 105 GRTRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSE 159 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 33.9 bits (74), Expect = 0.052 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 +L+IG ++ D EE + + FS FGE E + K++ G Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTG 44 Score = 30.7 bits (66), Expect = 0.48 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 7/55 (12%) Frame = +1 Query: 115 GRSR-LYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 GR+R +++G L + VTE + F FG +++ + + + FGFI D E Sbjct: 105 GRTRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSE 159 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 33.5 bits (73), Expect = 0.068 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 6/52 (11%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 ++L++ L+ T++ + ++FSPFG+ E L + K FGFI D E Sbjct: 7 AQLFVSRLSAYTTDQSLRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSE 58 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 33.1 bits (72), Expect = 0.090 Identities = 14/48 (29%), Positives = 30/48 (62%) Frame = +1 Query: 88 MEQSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKN 231 ++++ KF S LY+ NL +++E++ ++FSPFG + + ++ N Sbjct: 122 LKEAADKFQS-SNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPN 168 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 33.1 bits (72), Expect = 0.090 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 S+L+IG L+ V E+ + FS FGE +E+ + +K G Sbjct: 41 SKLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSG 79 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 33.1 bits (72), Expect = 0.090 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 5/56 (8%) Frame = +1 Query: 100 EVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFL-----NKEKNFGFIKMD 252 +VKF + +Y+ NL+ +++EE+ K+F FG + + K K FGF+ + Sbjct: 220 KVKF---TNVYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDGEGKSKGFGFVNFE 272 Score = 30.3 bits (65), Expect = 0.64 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFG 195 S LY+ NL VT++++ + F+PFG Sbjct: 327 SNLYVKNLDESVTDDKLREHFAPFG 351 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 33.1 bits (72), Expect = 0.090 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIK 246 +++G L + VT+E++ + FS FGE + + K GF++ Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGKGCGFVQ 347 >At1g04440.1 68414.m00435 casein kinase, putative similar to casein kinase I [Arabidopsis thaliana] gi|1103318|emb|CAA55395; contains protein kinase domain, Pfam:PF00069 Length = 468 Score = 33.1 bits (72), Expect = 0.090 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +3 Query: 270 RAKRELDGKLRNSRTLRVRFAPHNSAVRVKNLPPFVSNELLYRSFEI 410 R R + R+S TLR +FAP +S+V K P + ++ +S E+ Sbjct: 413 RLSRLIPNNDRSSTTLRTQFAPSSSSVATKAAPTRAARDITLQSLEL 459 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 32.7 bits (71), Expect = 0.12 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 ++++G L + VTE E K F+ FG +++ + + + FGFI D E Sbjct: 34 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSE 84 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 32.7 bits (71), Expect = 0.12 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 ++++G L + VTE E K F+ FG +++ + + + FGFI D E Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSE 157 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 +L+IG ++ + +E+ + F FGE E + K++ G Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATG 44 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 32.7 bits (71), Expect = 0.12 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 ++++G L + VTE E K F+ FG +++ + + + FGFI D E Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSE 157 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 +L+IG ++ + +E+ + F FGE E + K++ G Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATG 44 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 32.7 bits (71), Expect = 0.12 Identities = 14/56 (25%), Positives = 30/56 (53%), Gaps = 6/56 (10%) Frame = +1 Query: 109 FNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 +N ++++G L +T+EE + F +G +++ + N+ + FGF+ D E Sbjct: 106 YNKTKKIFVGGLPPTLTDEEFRQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSE 161 Score = 28.3 bits (60), Expect = 2.6 Identities = 9/40 (22%), Positives = 26/40 (65%) Frame = +1 Query: 118 RSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 + +L++G ++ + E+++ + F+ +GE S+ + ++K G Sbjct: 5 QGKLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTG 44 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 32.7 bits (71), Expect = 0.12 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFL 216 L+I NL DVT+EE+ + F+ FGE L L Sbjct: 563 LFIRNLPFDVTKEEVKQRFTVFGEVESLSL 592 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 32.7 bits (71), Expect = 0.12 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 6/58 (10%) Frame = +1 Query: 88 MEQSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFI 243 M+ E N SR+++G L+ DVTE ++ F +G+ +E + + + FGFI Sbjct: 1 MKDRENDGNLESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFI 58 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 32.7 bits (71), Expect = 0.12 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 6/58 (10%) Frame = +1 Query: 88 MEQSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFI 243 M+ E N SR+++G L+ DVTE ++ F +G+ +E + + + FGFI Sbjct: 1 MKDRENDGNLESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFI 58 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 32.7 bits (71), Expect = 0.12 Identities = 16/46 (34%), Positives = 30/46 (65%), Gaps = 5/46 (10%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGE--ASELFLNKE---KNFGFI 243 + LY+ NL + V +E++ +MFS +G +S++ LN + + FGF+ Sbjct: 332 ANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQGMSRGFGFV 377 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 32.3 bits (70), Expect = 0.16 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 7/53 (13%) Frame = +1 Query: 115 GRSR-LYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD 252 GR++ +++G L + +TEEE F FG +++ + + + FGFI D Sbjct: 107 GRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFD 159 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 32.3 bits (70), Expect = 0.16 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 7/53 (13%) Frame = +1 Query: 115 GRSR-LYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD 252 GR++ +++G L + +TEEE F FG +++ + + + FGFI D Sbjct: 107 GRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFD 159 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 32.3 bits (70), Expect = 0.16 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 7/53 (13%) Frame = +1 Query: 115 GRSR-LYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD 252 GR++ +++G L + +TEEE F FG +++ + + + FGFI D Sbjct: 107 GRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFD 159 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 32.3 bits (70), Expect = 0.16 Identities = 10/35 (28%), Positives = 24/35 (68%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEK 228 +L++G+L TE+E+ ++F FG +++L +++ Sbjct: 212 KLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDE 246 Score = 31.5 bits (68), Expect = 0.28 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 +L++G++ TEEEI F G E+ L K+K G Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTG 158 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 32.3 bits (70), Expect = 0.16 Identities = 10/35 (28%), Positives = 24/35 (68%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEK 228 +L++G+L TE+E+ ++F FG +++L +++ Sbjct: 212 KLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDE 246 Score = 31.5 bits (68), Expect = 0.28 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 +L++G++ TEEEI F G E+ L K+K G Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTG 158 >At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 823 Score = 32.3 bits (70), Expect = 0.16 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 6/60 (10%) Frame = +1 Query: 91 EQSEVKFNGRSR------LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIKMD 252 E+ +K +GR R L++GNL + + E E+ F FGE L +++ F+ + Sbjct: 7 ERMMMKEDGRGRNPPSRHLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFN 66 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 32.3 bits (70), Expect = 0.16 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 ++LY+ ++ TE +I ++F +G +E+ L K+K G Sbjct: 110 AKLYVAPISKTATEYDIRQVFEKYGNVTEIILPKDKMTG 148 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 32.3 bits (70), Expect = 0.16 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +1 Query: 112 NGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 N + ++Y+ N++ D+ +++++ FS FGE E L +K G Sbjct: 224 NVQRKIYVSNVSADIDPQKLLEFFSRFGEIEEGPLGLDKATG 265 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 32.3 bits (70), Expect = 0.16 Identities = 15/46 (32%), Positives = 29/46 (63%), Gaps = 5/46 (10%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEAS--ELFLNKE---KNFGFI 243 S LY+ NL + V +E++ +MFS +G + ++ +N + + FGF+ Sbjct: 328 SNLYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNSQGLSRGFGFV 373 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 32.3 bits (70), Expect = 0.16 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLN---KEKNFGFIKMD 252 +Y+GNL D+ E E+ +FS +G ++ L + + F++ D Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFD 53 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 32.3 bits (70), Expect = 0.16 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLN---KEKNFGFIKMD 252 +Y+GNL D+ E E+ +FS +G ++ L + + F++ D Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFD 53 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 32.3 bits (70), Expect = 0.16 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLN---KEKNFGFIKMD 252 +Y+GNL D+ E E+ +FS +G ++ L + + F++ D Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFD 53 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 31.9 bits (69), Expect = 0.21 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIK 246 +++G L +VT++E+ +F FGE + + K GF++ Sbjct: 262 IFVGGLDANVTDDELKSIFGQFGELLHVKIPPGKRCGFVQ 301 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 31.9 bits (69), Expect = 0.21 Identities = 12/39 (30%), Positives = 26/39 (66%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 SR+++G L+ +VT+ ++ + FS FG+ + + E++ G Sbjct: 7 SRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTG 45 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 31.9 bits (69), Expect = 0.21 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIK 246 +++G L + VT+E++ + F+ FGE + + K GF++ Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGKGCGFVQ 345 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 31.5 bits (68), Expect = 0.28 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Frame = +1 Query: 85 PMEQSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFGE------ASELFLNKEKNFGFIK 246 P Q V ++ R+Y+GNL DV + ++FS G+ S+ + + FGF++ Sbjct: 196 PERQPRV-YDAAFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQ 254 Query: 247 MD*E 258 M E Sbjct: 255 MSNE 258 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 31.5 bits (68), Expect = 0.28 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKE-----KNFGFIKMD 252 LYI NL V+EE + MFS FG+ L K+ + F FI+ + Sbjct: 19 LYIANLDAQVSEEMLFLMFSDFGKVIRSVLAKDFRGESRGFAFIEFE 65 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 31.5 bits (68), Expect = 0.28 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIK 246 +++G + DV +E++ + FS FGE + + K GF++ Sbjct: 323 IFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGCGFVQ 362 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 31.5 bits (68), Expect = 0.28 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGE------ASELFLNKEKNFGFI 243 +++++GNLT T +++ + F FG+ SE + + K +GFI Sbjct: 12 TKIFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFI 58 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 31.5 bits (68), Expect = 0.28 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFL-----NKEKNFGFI 243 S +Y+ N+ VTEEE+ K FS G + L K K FGF+ Sbjct: 304 SNIYVKNVNVAVTEEELRKHFSQCGTITSTKLMCDEKGKSKGFGFV 349 Score = 30.7 bits (66), Expect = 0.48 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKN 231 + LY+ NL DV+E+ + + F+ FG+ L + K++N Sbjct: 201 TNLYMKNLDADVSEDLLREKFAEFGKIVSLAIAKDEN 237 Score = 27.5 bits (58), Expect = 4.5 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +3 Query: 309 RTLRVRFAPHNSAVRVKNLPPFVSNELLYRSFEIFGKIERAYVKVDE 449 +T RV+ + + +KNL VS +LL F FGKI + DE Sbjct: 190 KTDRVKPEEKYTNLYMKNLDADVSEDLLREKFAEFGKIVSLAIAKDE 236 Score = 27.1 bits (57), Expect = 5.9 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = +3 Query: 285 LDGKL-RNSRTLRVRFAPHNSA--VRVKNLPPFVSNELLYRSFEIFGKI 422 L+GK+ R ++R A N V VKNLP V+N +L F+ FG I Sbjct: 90 LNGKMIRVMWSVRAPDARRNGVGNVFVKNLPESVTNAVLQDMFKKFGNI 138 >At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 31.5 bits (68), Expect = 0.28 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFL-NKEKNFGFIKMD*E 258 +R+Y+GNL VTE E+ F FG +++ + + F++ D E Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDE 48 >At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 31.5 bits (68), Expect = 0.28 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFL-NKEKNFGFIKMD*E 258 +R+Y+GNL VTE E+ F FG +++ + + F++ D E Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDE 48 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 31.1 bits (67), Expect = 0.36 Identities = 10/38 (26%), Positives = 22/38 (57%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 ++++G L + T E +K F +GE ++ + K++ G Sbjct: 43 KIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTG 80 Score = 27.1 bits (57), Expect = 5.9 Identities = 9/38 (23%), Positives = 22/38 (57%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 ++++G + + V ++E + F FGE E + ++ + G Sbjct: 131 KIFVGGIPSSVDDDEFKEFFMQFGELKEHQIMRDHSTG 168 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 31.1 bits (67), Expect = 0.36 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFL 216 +Y+GNL D+ E E+ +FS +G ++ L Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDL 38 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 31.1 bits (67), Expect = 0.36 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFL 216 +Y+GNL D+ E E+ +FS +G ++ L Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDL 38 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 31.1 bits (67), Expect = 0.36 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 S ++IG L DV EE++ + GE E+ L K+++ G Sbjct: 116 SEVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSG 154 Score = 27.5 bits (58), Expect = 4.5 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 118 RSRLYIGNLTNDVTEEEIMKMFSPFGEASE 207 ++RL+IGN+ + TE+E K+ G E Sbjct: 195 KNRLFIGNIPKNWTEDEFRKVIEDVGPGVE 224 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 31.1 bits (67), Expect = 0.36 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIK 246 + + + + EE+I F FGE L LN ++ G++K Sbjct: 97 ILVSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRSGYVK 136 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 30.7 bits (66), Expect = 0.48 Identities = 13/41 (31%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFG--EASELFLNKEKNFGFI 243 +Y+GN+ VTE + ++F+ G E+S+L + ++GF+ Sbjct: 61 VYVGNIHTQVTEPLLQEIFTSTGPVESSKLIRKDKSSYGFV 101 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 30.7 bits (66), Expect = 0.48 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = +1 Query: 118 RSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKN 231 +S LY+ NL +T +I +FS FG+ + + + K+++ Sbjct: 56 KSTLYVSNLDFSLTNSDIHTLFSTFGKVARVTVLKDRH 93 >At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing protein Length = 830 Score = 30.7 bits (66), Expect = 0.48 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFI 243 L++ N+ + V + E+ +F PFGE L+ K+ GF+ Sbjct: 187 LFVRNINSSVEDSELSALFEPFGEIRSLY-TACKSRGFV 224 >At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing protein Length = 843 Score = 30.7 bits (66), Expect = 0.48 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFI 243 L++ N+ + V + E+ +F PFGE L+ K+ GF+ Sbjct: 200 LFVRNINSSVEDSELSALFEPFGEIRSLY-TACKSRGFV 237 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 30.7 bits (66), Expect = 0.48 Identities = 13/30 (43%), Positives = 23/30 (76%) Frame = +1 Query: 106 KFNGRSRLYIGNLTNDVTEEEIMKMFSPFG 195 KF+G + LY+ NL + VT+E++ ++F+ FG Sbjct: 324 KFDGLN-LYVKNLDDTVTDEKLRELFAEFG 352 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 30.7 bits (66), Expect = 0.48 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +1 Query: 130 YIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIKMD*ELMQREQNVNW 288 Y+GNL +D E ++ FS FG+ + N +F F +D E E + Sbjct: 11 YVGNLESDTEENDLKNAFSQFGDV--IHSNVRFSFHFSLIDYEYFDYENGYEY 61 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 30.7 bits (66), Expect = 0.48 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = +1 Query: 76 DLPPMEQSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASEL 210 +L ++ + N +L++G L +V+E E+ +FS +G +L Sbjct: 94 ELERLDVLDCSCNPEHKLFVGMLPKNVSETEVQSLFSEYGTIKDL 138 Score = 30.7 bits (66), Expect = 0.48 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGE--ASELFLNK----EKNFGFIKMD 252 + L+I N+ + ++E+ F PFG+ ++++F++K K FGFI D Sbjct: 339 ANLFIYNIPREFEDQELAATFQPFGKVLSAKVFVDKATGISKCFGFISYD 388 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/47 (25%), Positives = 27/47 (57%) Frame = +1 Query: 88 MEQSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEK 228 M + ++ R +L++G + +TE +++ +F F +E+ + KEK Sbjct: 1 MAEETMENEERVKLFVGQVPKHMTEIQLLTLFREFSIVNEVNIIKEK 47 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 30.7 bits (66), Expect = 0.48 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGE--ASELFLNK----EKNFGFIKMD 252 + L+I N+ + ++E+ F PFG+ ++++F++K K FGFI D Sbjct: 330 ANLFIYNIPREFEDQELAATFQPFGKVLSAKVFVDKATGISKCFGFISYD 379 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/47 (25%), Positives = 27/47 (57%) Frame = +1 Query: 88 MEQSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEK 228 M + ++ R +L++G + +TE +++ +F F +E+ + KEK Sbjct: 1 MAEETMENEERVKLFVGQVPKHMTEIQLLTLFREFSIVNEVNIIKEK 47 Score = 28.7 bits (61), Expect = 1.9 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASEL 210 +L++G L +V+E E+ +FS +G +L Sbjct: 101 KLFVGMLPKNVSETEVQSLFSEYGTIKDL 129 >At5g16260.1 68418.m01899 RNA recognition motif (RRM)-containing protein similar to Tat-SF1 - Homo sapiens, GI:1667611; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 519 Score = 30.3 bits (65), Expect = 0.64 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +1 Query: 82 PPMEQSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASE 207 PP E+K N +Y+ L +DVT EE+ ++FS G E Sbjct: 265 PPDSWFELKVN--PHIYVNGLPDDVTIEEVAEVFSKCGIIKE 304 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 30.3 bits (65), Expect = 0.64 Identities = 18/47 (38%), Positives = 30/47 (63%), Gaps = 6/47 (12%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFG--EASELFLNKE----KNFGFIK 246 +LY+GNL +++E ++ ++F FG E +L L+ E K FGFI+ Sbjct: 266 KLYVGNLHFNMSELQLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQ 312 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 30.3 bits (65), Expect = 0.64 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIK 246 +++G + VTE+++ +F FGE + + K GF++ Sbjct: 280 IFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAGKRCGFVQ 319 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 30.3 bits (65), Expect = 0.64 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 S +Y+G + D TE ++ GE +E+ + +EK+ G Sbjct: 92 SEVYLGGIPTDATEGDLKGFCGSIGEVTEVRIMREKDSG 130 Score = 26.6 bits (56), Expect = 7.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEK 228 LYI NL D+T+E + +F G+ ++ + K Sbjct: 270 LYIKNLPRDITQERLKALFEHHGKILKVVIPPAK 303 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 30.3 bits (65), Expect = 0.64 Identities = 14/51 (27%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 ++++G + + VTE+E+ F+ +G E + N+ + FGF+ D E Sbjct: 110 KIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSE 160 Score = 27.1 bits (57), Expect = 5.9 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 +++IG L D T K F +GE ++ + ++++ G Sbjct: 20 KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTG 57 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 30.3 bits (65), Expect = 0.64 Identities = 14/51 (27%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 ++++G + + VTE+E+ F+ +G E + N+ + FGF+ D E Sbjct: 110 KIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSE 160 Score = 27.1 bits (57), Expect = 5.9 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 +++IG L D T K F +GE ++ + ++++ G Sbjct: 20 KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTG 57 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 29.9 bits (64), Expect = 0.84 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFL-NKEKNFGFIKMD 252 SR+Y+GNL VTE E+ F FG +++ + + F+ + Sbjct: 2 SRVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPGYAFLDFE 46 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 29.9 bits (64), Expect = 0.84 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 ++++G L + +TE E F FG +++ + + + FGFI D E Sbjct: 123 KIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSE 173 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 29.9 bits (64), Expect = 0.84 Identities = 10/40 (25%), Positives = 24/40 (60%) Frame = +1 Query: 115 GRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNF 234 G +RLY+G L++ ++ ++FS +G ++ + ++ F Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAF 48 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 29.9 bits (64), Expect = 0.84 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 6/48 (12%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKM 249 RLY+GNL +T E+ ++F G ++ + ++ + FGF+ M Sbjct: 117 RLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSRGFGFVTM 164 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 29.9 bits (64), Expect = 0.84 Identities = 10/40 (25%), Positives = 24/40 (60%) Frame = +1 Query: 115 GRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNF 234 G +RLY+G L++ ++ ++FS +G ++ + ++ F Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAF 48 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 29.9 bits (64), Expect = 0.84 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 118 RSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 + +L+IG ++ D E + + FS FGE ++ + +EK G Sbjct: 5 QGKLFIGGISWDTDENLLREYFSNFGEVLQVTVMREKATG 44 >At1g66260.1 68414.m07522 RNA and export factor-binding protein, putative similar to GI:7159943 from [Mus musculus] (RNA 6 (4), 638-650 (2000)) Length = 295 Score = 29.9 bits (64), Expect = 0.84 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKN 231 +YI NL VT E+I ++++ GE ++ +KN Sbjct: 109 VYITNLDQGVTNEDIRELYAEIGELKRYAIHYDKN 143 >At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 177 Score = 29.9 bits (64), Expect = 0.84 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 6/48 (12%) Frame = +1 Query: 118 RSRLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFI 243 ++ LY+G L ++V E + F PFG+ ++ K ++FGF+ Sbjct: 12 KNTLYVGGLADEVNESILHAAFIPFGDIKDVKTPLDQANQKHRSFGFV 59 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 29.5 bits (63), Expect = 1.1 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASEL 210 +R+YI NL DVT +E+ +F G+ + Sbjct: 280 ARIYISNLPPDVTTDELKDLFGGIGQVGRI 309 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 29.5 bits (63), Expect = 1.1 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASEL 210 +R+YI NL DVT +E+ +F G+ + Sbjct: 280 ARIYISNLPPDVTTDELKDLFGGIGQVGRI 309 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 29.5 bits (63), Expect = 1.1 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 333 PHNSAVRVKNLPPFVSNELLYRSFEIFGKIERAYVKVDE 449 P S + V+NLP S + L R F FG+I + DE Sbjct: 37 PLASKIMVRNLPFSTSEDFLKREFSAFGEIAEVKLIKDE 75 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 29.5 bits (63), Expect = 1.1 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Frame = +1 Query: 64 GPLFDLPPMEQSEVKFNGRSR----LYIGNLTNDVTEEEIMKMFSPFGEASELFLNK 222 G D+ E +V R R +++G+L +EE++ K+F GE +E+ + K Sbjct: 191 GETVDVEEEEHHDVLHERRKRKEFEIFVGSLDKGASEEDLKKVFGHVGEVTEVRILK 247 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 29.5 bits (63), Expect = 1.1 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFG 195 SR+Y+GNL VTE E+ F FG Sbjct: 2 SRVYVGNLDPRVTERELEDEFRSFG 26 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 29.5 bits (63), Expect = 1.1 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIK 246 +++G L VT++ + +FS +GE + + K GF++ Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQ 302 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 29.5 bits (63), Expect = 1.1 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFIK 246 +++G L VT++ + +FS +GE + + K GF++ Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQ 302 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 29.1 bits (62), Expect = 1.5 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFG 195 +Y+G L D+TEE + ++FS +G Sbjct: 9 VYVGGLPYDITEEAVRRVFSIYG 31 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEA------SELFLNKEKNFGFI 243 +R+Y+GNL+ T++ + + FS +G + + ++ + FGF+ Sbjct: 3 TRVYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFV 49 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 29.1 bits (62), Expect = 1.5 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 5/63 (7%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFL-----NKEKNFGFIKMD*ELMQREQNVNW 288 +L++G L +V+E E+ +FS +G +L + K F+K + +EQ V+ Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYE----TKEQAVSA 162 Query: 289 MEN 297 ME+ Sbjct: 163 MES 165 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 29.1 bits (62), Expect = 1.5 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 5/63 (7%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFL-----NKEKNFGFIKMD*ELMQREQNVNW 288 +L++G L +V+E E+ +FS +G +L + K F+K + +EQ V+ Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYE----TKEQAVSA 162 Query: 289 MEN 297 ME+ Sbjct: 163 MES 165 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 29.1 bits (62), Expect = 1.5 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 6/48 (12%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASEL------FLNKEKNFGFIKM 249 R+YIGN+ VT E++ K+ G ++ + + + FGF M Sbjct: 77 RVYIGNIPRTVTNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFGFATM 124 Score = 27.5 bits (58), Expect = 4.5 Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 76 DLPPMEQSEVKF-NGRSRLYIGNLTNDVTEEEIMKMFSPFGE 198 DL ++ + F + ++Y+GNL VT+E + +FS G+ Sbjct: 161 DLSVLQSEDSAFVDSPYKVYVGNLAKTVTKEMLENLFSEKGK 202 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/52 (23%), Positives = 28/52 (53%), Gaps = 5/52 (9%) Frame = +1 Query: 106 KFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKE-----KNFGFIK 246 + +GR +++ NL + +++ MFS FG+ + ++ K +GF++ Sbjct: 26 RMSGRGNVFVKNLDESIDNKQLCDMFSAFGKVLSCKVARDASGVSKGYGFVQ 77 Score = 26.6 bits (56), Expect = 7.8 Identities = 15/52 (28%), Positives = 30/52 (57%) Frame = +1 Query: 40 SNKLKDLQGPLFDLPPMEQSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFG 195 +N+ +DL+ F+L + + ++K LY+ NL + V ++ ++FS FG Sbjct: 198 TNRTEDLKAK-FELEKIIR-DMKTRKGMNLYVKNLDDSVDNTKLEELFSEFG 247 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 28.7 bits (61), Expect = 1.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFL 216 +Y+GNL D+ E EI +F +G ++ L Sbjct: 9 IYVGNLPGDIREHEIEDIFYKYGRIVDIEL 38 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 28.7 bits (61), Expect = 1.9 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 +++++G L + +E+ + F FGE E + +KN G Sbjct: 17 TKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTG 55 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 28.7 bits (61), Expect = 1.9 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 +++++G L + +E+ + F FGE E + +KN G Sbjct: 17 TKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTG 55 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 28.7 bits (61), Expect = 1.9 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 94 QSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 QS V NG + L++G L T+ EI + S +G E+ E+ G Sbjct: 193 QSFVVDNGNTMLFVGELHWWTTDAEIESVLSQYGRVKEIKFFDERVSG 240 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 28.3 bits (60), Expect = 2.6 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFGFI 243 L +GN++++V + E+ +F FG+ L KN GFI Sbjct: 219 LLVGNISSNVEDYELKVLFEQFGDIQALH-TACKNRGFI 256 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKN 231 L++ NL + ++ EE+ +FS +GE E+ +N Sbjct: 297 LWVNNLDSSISNEELHGIFSSYGEIREVRRTMHEN 331 >At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 28.3 bits (60), Expect = 2.6 Identities = 9/32 (28%), Positives = 22/32 (68%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFL 216 ++L++ N+ + T +E+ ++F+PFG+ + L Sbjct: 351 TKLHVKNIAFEATMKEVRQLFTPFGQIKSVGL 382 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 28.3 bits (60), Expect = 2.6 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 6/48 (12%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKM 249 R+Y+GNL DV + ++FS G+ E + + + FGF+ M Sbjct: 245 RVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTM 292 >At3g20410.1 68416.m02585 calmodulin-domain protein kinase isoform 9 (CPK9) identical to calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis thaliana] gi|1399265|gb|AAB03242 Length = 541 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 378 SNELLYRSFEIFGKIERAYVKVDE 449 SNE LY++F+ F K Y+ +DE Sbjct: 465 SNENLYKAFQHFDKDSSGYITIDE 488 >At5g53180.1 68418.m06611 polypyrimidine tract-binding protein, putative / heterogeneous nuclear ribonucleoprotein, putative similar to Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) from {Rattus norvegicus} SP|Q00438, {Homo sapiens} SP|P26599; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 27.9 bits (59), Expect = 3.4 Identities = 16/56 (28%), Positives = 33/56 (58%), Gaps = 2/56 (3%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEA--SELFLNKEKNFGFIKMD*ELMQREQNVNW 288 L++ NL + TEEE++++ PFG ++ + +N FI+ + +L Q Q +++ Sbjct: 20 LHLRNLPWECTEEELIELGKPFGTVVNTKCNVGANRNQAFIEFE-DLNQAIQMISY 74 >At5g02530.1 68418.m00187 RNA and export factor-binding protein, putative BcDNA.LD24793, Drosophila melanogaster, EMBL:AF172637 Length = 292 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKN 231 ++LYI NL V+ E+I ++FS G+ ++ +++ Sbjct: 108 TKLYISNLDYGVSNEDIKELFSEVGDLKRYGIHYDRS 144 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 27.9 bits (59), Expect = 3.4 Identities = 12/41 (29%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFG--EASELFLNKEKNFGFI 243 +Y+GN+ VTE + ++F+ G E+ +L ++ ++GF+ Sbjct: 56 VYVGNIHIQVTEPLLQEVFAGTGPVESCKLIRKEKSSYGFV 96 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 27.5 bits (58), Expect = 4.5 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 6/47 (12%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEA--SELFLNKE----KNFGFI 243 S+L+IG + + E+ + + F+ +GE + + L++E + FGF+ Sbjct: 40 SKLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSRGFGFV 86 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 27.5 bits (58), Expect = 4.5 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 118 RSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 + ++Y+ N+ ++ ++++ FS FGE E L +K G Sbjct: 244 QKKIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTG 283 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 27.5 bits (58), Expect = 4.5 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 118 RSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 + ++Y+ N+ ++ ++++ FS FGE E L +K G Sbjct: 244 QKKIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTG 283 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 27.5 bits (58), Expect = 4.5 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 118 RSRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 + ++Y+ N+ ++ ++++ FS FGE E L +K G Sbjct: 244 QKKIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTG 283 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 27.5 bits (58), Expect = 4.5 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 342 SAVRVKNLPPFVSNELLYRSFEIFGKIERAYVKVDER 452 ++VRV NL L F FG + R YV +D++ Sbjct: 213 NSVRVTNLSEDTREPDLMELFHPFGAVTRVYVAIDQK 249 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASEL 210 +++GNL V ++ I+K FS FGE + Sbjct: 173 VFVGNLPLKVKKKVILKEFSKFGEVESV 200 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFI 243 S+L+IG L+ TE+ + + FS G+ E + ++ K FGF+ Sbjct: 34 SKLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFV 80 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 6/56 (10%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEA--SELFLNKE----KNFGFIKMD*ELMQRE 273 R ++G L +E++ + FS FG+ S++ ++E + FGF+ E R+ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRD 62 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 6/56 (10%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEA--SELFLNKE----KNFGFIKMD*ELMQRE 273 R ++G L +E++ + FS FG+ S++ ++E + FGF+ E R+ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRD 62 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 6/56 (10%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEA--SELFLNKE----KNFGFIKMD*ELMQRE 273 R ++G L +E++ + FS FG+ S++ ++E + FGF+ E R+ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRD 62 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 6/56 (10%) Frame = +1 Query: 124 RLYIGNLTNDVTEEEIMKMFSPFGEA--SELFLNKE----KNFGFIKMD*ELMQRE 273 R ++G L +E++ + FS FG+ S++ ++E + FGF+ E R+ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRD 62 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD 252 +R+Y+GNL+ V + + +FS G+ E + + K FGF+ D Sbjct: 204 NRVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYD 253 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 6/52 (11%) Frame = +1 Query: 112 NGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKM 249 N + LY+ L++ VTE ++ F+ G+ +++ L + + FGFI M Sbjct: 42 NPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISM 93 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 6/52 (11%) Frame = +1 Query: 112 NGRSRLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKM 249 N + LY+ L++ VTE ++ F+ G+ +++ L + + FGFI M Sbjct: 72 NPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISM 123 >At5g28390.1 68418.m03447 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 180 Score = 26.6 bits (56), Expect = 7.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 127 LYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEK 228 LYI NL D+T+E + +F G+ ++ + K Sbjct: 36 LYIKNLPRDITQERLKALFEHHGKILKVVIPPAK 69 >At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 130 Score = 26.6 bits (56), Expect = 7.8 Identities = 12/38 (31%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGE-ASELFLNKEKN 231 S L++ ++ V+E + K+FS FG+ +E + + KN Sbjct: 58 SSLFVKGFSDSVSEGRLKKVFSEFGQVTNEHYFSGSKN 95 >At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 363 Score = 26.6 bits (56), Expect = 7.8 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +1 Query: 46 KLKDLQGPLFDLPPMEQSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFGEASEL 210 KL G + L P E +K LY+G L + + E++I F +GE + Sbjct: 205 KLLRKAGEMGTLEPPEDESIK-----TLYVGGLNSRIFEQDIHDHFYAYGEMESI 254 >At4g10610.1 68417.m01735 RNA-binding protein, putative Length = 336 Score = 26.6 bits (56), Expect = 7.8 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +1 Query: 118 RSRLYIGNLTNDVTEEEIMKMFSPFGEASELFL----NKEKNFGFIKMD*ELMQR 270 R +Y+ ++ VTEE++ +F FG+ + + N F FI+ E+ R Sbjct: 149 RRTVYVSDIDQQVTEEQLAGLFIGFGQVVDCRICGDPNSVLRFAFIEFTDEVGAR 203 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 26.6 bits (56), Expect = 7.8 Identities = 13/52 (25%), Positives = 26/52 (50%), Gaps = 6/52 (11%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 S+L++G L+ + + + F+ FGE +E + + + FGF+ E Sbjct: 35 SKLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCE 86 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 26.6 bits (56), Expect = 7.8 Identities = 13/52 (25%), Positives = 26/52 (50%), Gaps = 6/52 (11%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFL------NKEKNFGFIKMD*E 258 S+L++G L+ + + + F+ FGE +E + + + FGF+ E Sbjct: 35 SKLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCE 86 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 26.6 bits (56), Expect = 7.8 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +1 Query: 121 SRLYIGNLTNDVTEEEIMKMFSPFGEASELFLNKEKNFG 237 +++++G L + + + + F FGE E + +KN G Sbjct: 22 TKIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTG 60 >At2g21850.1 68415.m02596 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 772 Score = 26.6 bits (56), Expect = 7.8 Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -1 Query: 418 FP-NISNERYNSSFETNGGRFFTRTALLCGANL 323 FP N+ N+++ + + G R+F LCG + Sbjct: 626 FPDNVKNQKHEHTLKLIGSRYFEPDCFLCGERI 658 >At2g19180.1 68415.m02238 expressed protein Length = 179 Score = 26.6 bits (56), Expect = 7.8 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 64 GPLFDLPPMEQSEVKFNGRSRLYIGNLTNDVTEEEIMKMFSPFG 195 G F +PP + + K + +TN +TEEE + + SP+G Sbjct: 85 GSSFWVPPHQITATKIAN----LVDKVTNPLTEEESLSLSSPYG 124 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,676,251 Number of Sequences: 28952 Number of extensions: 185754 Number of successful extensions: 630 Number of sequences better than 10.0: 125 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 742437000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -