BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0690 (623 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341231-1|AAR13795.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 1.5 AY341230-1|AAR13794.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 1.5 AY341229-1|AAR13793.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 1.5 AY341228-1|AAR13792.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 1.5 AY341227-1|AAR13791.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 1.5 AY341226-1|AAR13790.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 1.5 AY341225-1|AAR13789.1| 231|Anopheles gambiae vacuolar ATPase pr... 25 1.5 AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive ... 25 2.0 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 25 2.6 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 2.6 AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase ... 24 3.4 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 4.5 Z22930-1|CAA80513.1| 273|Anopheles gambiae trypsin-related prot... 23 6.0 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 6.0 L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase... 23 7.9 L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase... 23 7.9 >AY341231-1|AAR13795.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.4 bits (53), Expect = 1.5 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 481 LHTSLGLPHSHIACKFCRKS 540 + ++ GLPH+ IA + CR++ Sbjct: 26 IFSAAGLPHNEIAAQICRQA 45 >AY341230-1|AAR13794.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.4 bits (53), Expect = 1.5 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 481 LHTSLGLPHSHIACKFCRKS 540 + ++ GLPH+ IA + CR++ Sbjct: 26 IFSAAGLPHNEIAAQICRQA 45 >AY341229-1|AAR13793.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.4 bits (53), Expect = 1.5 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 481 LHTSLGLPHSHIACKFCRKS 540 + ++ GLPH+ IA + CR++ Sbjct: 26 IFSAAGLPHNEIAAQICRQA 45 >AY341228-1|AAR13792.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.4 bits (53), Expect = 1.5 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 481 LHTSLGLPHSHIACKFCRKS 540 + ++ GLPH+ IA + CR++ Sbjct: 26 IFSAAGLPHNEIAAQICRQA 45 >AY341227-1|AAR13791.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.4 bits (53), Expect = 1.5 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 481 LHTSLGLPHSHIACKFCRKS 540 + ++ GLPH+ IA + CR++ Sbjct: 26 IFSAAGLPHNEIAAQICRQA 45 >AY341226-1|AAR13790.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.4 bits (53), Expect = 1.5 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 481 LHTSLGLPHSHIACKFCRKS 540 + ++ GLPH+ IA + CR++ Sbjct: 26 IFSAAGLPHNEIAAQICRQA 45 >AY341225-1|AAR13789.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 25.4 bits (53), Expect = 1.5 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 481 LHTSLGLPHSHIACKFCRKS 540 + ++ GLPH+ IA + CR++ Sbjct: 26 IFSAAGLPHNEIAAQICRQA 45 >AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive chymotrypsin-likeserine protease-related protein ISPR1 protein. Length = 187 Score = 25.0 bits (52), Expect = 2.0 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 471 SQTVTHQSWIATLPHCLQILQKIQEK 548 S ++ WI T HC+ +LQ E+ Sbjct: 67 SGSIVGDRWILTAEHCVPLLQFFSER 92 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 24.6 bits (51), Expect = 2.6 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -2 Query: 247 TMVPGFNTPVSTLPTGTVPIPPILYTSXWG 158 T PG P+S L G V P YT+ G Sbjct: 453 TPSPGIGGPISPLDPGNVTPTPPAYTTLGG 482 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 2.6 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +1 Query: 79 KLTENASLKLSMPSCHLPAP--LTSPCVFPXKTYTKSVVLVPCPSAELK 219 +L + L +PSC LP P + P P KS C + L+ Sbjct: 90 ELVTRSLSNLELPSCRLPCPNLIPRPAEVPTTPEHKSAASSSCSLSTLE 138 >AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase protein. Length = 259 Score = 24.2 bits (50), Expect = 3.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 471 SQTVTHQSWIATLPHCLQ 524 S ++ +Q WI T HCL+ Sbjct: 54 SGSIINQRWILTAAHCLE 71 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.8 bits (49), Expect = 4.5 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 123 PPARPTDKPLRLP 161 P +RPT KP RLP Sbjct: 289 PRSRPTSKPKRLP 301 >Z22930-1|CAA80513.1| 273|Anopheles gambiae trypsin-related protease protein. Length = 273 Score = 23.4 bits (48), Expect = 6.0 Identities = 6/25 (24%), Positives = 14/25 (56%) Frame = +3 Query: 477 TVTHQSWIATLPHCLQILQKIQEKV 551 ++ + WI T HC+ + +++ V Sbjct: 75 SILNSKWILTAAHCIDLYSQVKPTV 99 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.4 bits (48), Expect = 6.0 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = -3 Query: 237 LVSTHQFQLCRRARYQYHRFCIRLXGEDAGACQWGGQVAGWHR 109 + T+ +LC +Q H RL G G+ G +HR Sbjct: 191 ITRTNAERLCSSLLHQAHELRPRLKGGGPGSALLNGSFRVYHR 233 >L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 527 FAENPRKS*PSYXVILLKSTXNSIKVWRCSH 619 + + PR S P ++LL + I WR +H Sbjct: 283 YRDEPRFSQPHQLLMLLMDIDSLITKWRYNH 313 >L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 527 FAENPRKS*PSYXVILLKSTXNSIKVWRCSH 619 + + PR S P ++LL + I WR +H Sbjct: 283 YRDEPRFSQPHQLLMLLMDIDSLITKWRYNH 313 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 739,545 Number of Sequences: 2352 Number of extensions: 15993 Number of successful extensions: 45 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -