BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0670 (765 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.5 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 8.2 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.2 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 21 8.2 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 3.5 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +2 Query: 293 DGPELDSESKKAASVTPKHTPVKRMSLPSPGSTPFPNK-SSQKERLLNITRSIEKSRRSS 469 +G E D+ S S P + + P+PG P P+ S E LN R + SR +S Sbjct: 29 EGDE-DTGSMTPNSAASPAPPEEEAASPTPGDVPTPSSPRSISEDPLN-CRDLPNSRCNS 86 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 546 LLTENSWVINWTANITFVVL 487 L+ N++ + WT + FVVL Sbjct: 110 LVVANAFFLLWTPAVIFVVL 129 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 434 YLIIFLFVSSYLEMVWI 384 YLII +YLE WI Sbjct: 78 YLIILFADFAYLETTWI 94 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 434 YLIIFLFVSSYLEMVWI 384 YLII +YLE WI Sbjct: 96 YLIILFADFAYLETTWI 112 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,798 Number of Sequences: 336 Number of extensions: 2874 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -