BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0669 (489 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35062| Best HMM Match : IATP (HMM E-Value=1.7) 91 5e-19 SB_42612| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) 39 0.002 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 35 0.041 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 34 0.072 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.096 SB_35206| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.012) 33 0.13 SB_30512| Best HMM Match : GLTT (HMM E-Value=0.00058) 33 0.13 SB_54691| Best HMM Match : SWIRM (HMM E-Value=0.0033) 32 0.22 SB_20508| Best HMM Match : Filament (HMM E-Value=0.037) 32 0.29 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.29 SB_5816| Best HMM Match : RVT_1 (HMM E-Value=3e-16) 31 0.67 SB_43087| Best HMM Match : Ribosomal_S25 (HMM E-Value=3.2) 31 0.67 SB_27802| Best HMM Match : Filament (HMM E-Value=0.2) 30 1.2 SB_52092| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_45286| Best HMM Match : GRIP (HMM E-Value=3.6e-08) 30 1.2 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) 29 1.6 SB_12264| Best HMM Match : Filament (HMM E-Value=0.0075) 29 1.6 SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) 29 1.6 SB_2495| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.2e-11) 29 1.6 SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 29 2.1 SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_16761| Best HMM Match : PDZ (HMM E-Value=1.6e-08) 29 2.7 SB_16649| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_9721| Best HMM Match : Filament (HMM E-Value=0.2) 29 2.7 SB_48940| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) 29 2.7 SB_35536| Best HMM Match : zf-C2H2 (HMM E-Value=0.0069) 29 2.7 SB_33073| Best HMM Match : Protamine_P1 (HMM E-Value=1.5) 29 2.7 SB_30233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 29 2.7 SB_7846| Best HMM Match : CoCoA (HMM E-Value=0.00016) 29 2.7 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 28 3.6 SB_37872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_10610| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_1658| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.16) 28 3.6 SB_49818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) 28 4.7 SB_40853| Best HMM Match : BTB (HMM E-Value=1.4e-17) 28 4.7 SB_20162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_41916| Best HMM Match : DUF164 (HMM E-Value=0.8) 27 6.3 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 27 6.3 SB_21939| Best HMM Match : F-box (HMM E-Value=0.001) 27 6.3 SB_39125| Best HMM Match : DUF164 (HMM E-Value=0.082) 27 6.3 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_12753| Best HMM Match : M (HMM E-Value=0.0006) 27 6.3 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 27 8.3 SB_27760| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_17486| Best HMM Match : CheR (HMM E-Value=3.2) 27 8.3 SB_4107| Best HMM Match : M (HMM E-Value=8e-22) 27 8.3 >SB_35062| Best HMM Match : IATP (HMM E-Value=1.7) Length = 223 Score = 91.1 bits (216), Expect = 5e-19 Identities = 44/77 (57%), Positives = 61/77 (79%), Gaps = 1/77 (1%) Frame = +2 Query: 248 AREDA-LQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDA 424 A+E A LQ+LNDRLA YID+V+ LE ENS LR E+ +++ V REV ++K +YE EL DA Sbjct: 133 AQEKAELQHLNDRLATYIDRVKNLEQENSKLRSEVTVSRKTVEREVDSMKSLYETELADA 192 Query: 425 RKLLDDTSREKAKLEID 475 R+LLD+T++EKAK +I+ Sbjct: 193 RRLLDETAKEKAKQQIE 209 >SB_42612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 58.4 bits (135), Expect = 3e-09 Identities = 28/78 (35%), Positives = 49/78 (62%), Gaps = 2/78 (2%) Frame = +2 Query: 245 FAREDALQNLNDRLAAYIDKVRQLESENSGLRREIQ--TTQEVVTREVSNIKGMYEHELQ 418 + +D LQ+LNDR A YI +VRQ+ E++G I T +++ E+ +K MYE +L+ Sbjct: 12 YLEKDHLQSLNDRFANYISRVRQMR-EHNGRNETINFINTTKILEEEILALKAMYERQLE 70 Query: 419 DARKLLDDTSREKAKLEI 472 + R LDD +R++ + ++ Sbjct: 71 ELRSKLDDVARDRTQQQM 88 >SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) Length = 690 Score = 39.1 bits (87), Expect = 0.002 Identities = 19/77 (24%), Positives = 43/77 (55%) Frame = +2 Query: 233 QAKPFAREDALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHE 412 QAK + L+N +++ +K++ LE +NS + E + + E+ +K +E E Sbjct: 441 QAKYTSMLKDLKNERNKIIELEEKLKALEEQNSQRQEEYDSNKSTHENELLVLKAKHEEE 500 Query: 413 LQDARKLLDDTSREKAK 463 L++ ++ L++ +EK++ Sbjct: 501 LKETKQQLEELEKEKSE 517 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 34.7 bits (76), Expect = 0.041 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 10/88 (11%) Frame = +2 Query: 251 REDALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIK----------GM 400 R AL + ND L + ++ V+Q E +R++Q V T E+ +K G Sbjct: 1692 RMSALASENDHLNSELEMVKQSHQEMEKEKRKLQEKLRVTTDELIRLKPVSEATQKKKGQ 1751 Query: 401 YEHELQDARKLLDDTSREKAKLEIDLKR 484 E ELQ+ARK L + K E +L + Sbjct: 1752 VETELQNARKRLATLETTERKSEEELAK 1779 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 302 KVRQLESENSGLRREIQTTQEVVTREVSNIKGMYE--HELQDARKLLDDTSREKAK 463 KV Q SEN L ++ ++ +T NIK + E + LQ+ K L+D + E K Sbjct: 3047 KVSQKNSENELLHAQLDDLRKQITGYQGNIKSLEENSNRLQERIKDLEDENLESHK 3102 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 33.9 bits (74), Expect = 0.072 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 15/82 (18%) Frame = +2 Query: 266 QNLNDRLAA----YIDKVRQLESENSGL-----------RREIQTTQEVVTREVSNIKGM 400 + +N+RLA ++VR+L+ EN L RRE +E RE N++ Sbjct: 1798 EEMNNRLAREKKPLEEEVRELQEENEELKNQRWEMKVHFRREKVKLEEEFEREKENLETQ 1857 Query: 401 YEHELQDARKLLDDTSREKAKL 466 ++ E ++ R+ L+D +++KAK+ Sbjct: 1858 FDAEREEFRRRLEDRAQQKAKI 1879 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 33.5 bits (73), Expect = 0.096 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 6/88 (6%) Frame = +2 Query: 233 QAKPFAREDALQNLNDRLAAYIDKVRQLESE-NSGLRR--EIQTTQEVVTREVSNIKGMY 403 +A+ +D ++LND+L K+ +LES+ N +R E++ + +E+ + Y Sbjct: 774 EAESKLADDKRKDLNDQLVGCHGKISKLESQLNVANQRKFELEKALDEANKELKPLSDKY 833 Query: 404 EHELQD---ARKLLDDTSREKAKLEIDL 478 + +D +K LDDT A E+ L Sbjct: 834 DRASRDLDILQKTLDDTQSRLANAEMTL 861 >SB_35206| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.012) Length = 1148 Score = 33.1 bits (72), Expect = 0.13 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 6/78 (7%) Frame = +2 Query: 254 EDALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEH------EL 415 +D + LN + + + +++LE+ENSGL + E +EV +KG+ E EL Sbjct: 593 QDMVAKLNITIKSQKETMKKLETENSGLAASL----EKECKEVERLKGVDEEIVNIKIEL 648 Query: 416 QDARKLLDDTSREKAKLE 469 D + L +TS E K + Sbjct: 649 NDVQIKLRETSMELGKTQ 666 >SB_30512| Best HMM Match : GLTT (HMM E-Value=0.00058) Length = 1083 Score = 33.1 bits (72), Expect = 0.13 Identities = 19/63 (30%), Positives = 33/63 (52%) Frame = +2 Query: 299 DKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKLLDDTSREKAKLEIDL 478 +K + LE EN+ LR+ + TQE V + N + E E Q + + D + ++ E +L Sbjct: 284 EKYKLLEKENADLRQSVSETQE-VANSLQNRNSLLEREKQSLEENIQDLNVKQVVFE-EL 341 Query: 479 KRL 487 K + Sbjct: 342 KNV 344 >SB_54691| Best HMM Match : SWIRM (HMM E-Value=0.0033) Length = 809 Score = 32.3 bits (70), Expect = 0.22 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 6/78 (7%) Frame = +2 Query: 254 EDALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEH------EL 415 +D + LN + + + +++LE+ENSGL E +EV +KG+ E EL Sbjct: 666 QDMVAKLNITIKSQKETMKKLETENSGLAASF----EKECKEVERLKGVDEEIVNIKIEL 721 Query: 416 QDARKLLDDTSREKAKLE 469 D + L +TS E K + Sbjct: 722 NDVQIKLRETSMELGKTQ 739 >SB_20508| Best HMM Match : Filament (HMM E-Value=0.037) Length = 722 Score = 31.9 bits (69), Expect = 0.29 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +2 Query: 227 SYQAKPFARE-DALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMY 403 S Q ARE +AL+ L D A D + E EN+ + E T + + + S + + Sbjct: 409 SSQIAKLARELEALKILQDSTAKERDFYK--EHENAQ-QSETSTFKTQLVEQTSQLHAIT 465 Query: 404 EHELQDARKLLDDTSREKAKLEIDLKRL 487 + EL + LL+ T++EK LE+ K L Sbjct: 466 Q-ELASLKTLLETTAKEKETLEVSEKNL 492 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 31.9 bits (69), Expect = 0.29 Identities = 20/75 (26%), Positives = 41/75 (54%), Gaps = 1/75 (1%) Frame = +2 Query: 263 LQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKLLDD 442 L+ + +A + +LESE L+ E+Q + E ++ + I + + + ++L D+ Sbjct: 111 LRGRENEIAELKTSIGRLESELRSLKSELQNSSEKISEDEHEISQLKNDKARCMQELRDE 170 Query: 443 TSREKA-KLEIDLKR 484 REK+ KL +DL++ Sbjct: 171 --REKSNKLVVDLQK 183 >SB_5816| Best HMM Match : RVT_1 (HMM E-Value=3e-16) Length = 904 Score = 30.7 bits (66), Expect = 0.67 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -3 Query: 166 DCSGLCSDDTTLAFDEDVTVFL-VFVYLVGYIFVTITNFDTQ*CIF 32 D +GL SD+ + DED++ L VF L G + + I + DT C F Sbjct: 25 DKTGLSSDELRVLDDEDLSALLTVFKALYGDVDLRILDLDTTVCRF 70 >SB_43087| Best HMM Match : Ribosomal_S25 (HMM E-Value=3.2) Length = 134 Score = 30.7 bits (66), Expect = 0.67 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 4/79 (5%) Frame = +2 Query: 257 DALQNLNDRLAAYIDKVRQLESENSGLR-REIQTTQEVVTREVSNI---KGMYEHELQDA 424 + ++ L D LA + R+ ++ + ++ +EV T + + + E ELQ Sbjct: 36 EEIECLKDELATRTELTRRARDTAERMKGKMLEAKEEVGTEQQNKLDISSASTEEELQKT 95 Query: 425 RKLLDDTSREKAKLEIDLK 481 RK DD REK ++ +LK Sbjct: 96 RKERDDMRREKDQIISELK 114 >SB_27802| Best HMM Match : Filament (HMM E-Value=0.2) Length = 528 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 404 EHELQDARKLLDDTSREKAKLEIDLK 481 EHE Q+ KLL+D +E +KL+ LK Sbjct: 51 EHEKQNLTKLLEDAQKEVSKLKSSLK 76 >SB_52092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 29.9 bits (64), Expect = 1.2 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 5/74 (6%) Frame = +2 Query: 206 SSKQST*SYQAKPFAREDALQN-----LNDRLAAYIDKVRQLESENSGLRREIQTTQEVV 370 +S++ S +P R+ A N L +LAA + L E + LR+E+ TT++ + Sbjct: 141 ASQEGMPSVSLEPLQRDMARMNNSIFSLQQQLAAKESNISLLTRELASLRKELHTTRQFI 200 Query: 371 TREVSNIKGMYEHE 412 +N K + EH+ Sbjct: 201 NS--TNSKTLEEHQ 212 >SB_45286| Best HMM Match : GRIP (HMM E-Value=3.6e-08) Length = 800 Score = 29.9 bits (64), Expect = 1.2 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Frame = +2 Query: 284 LAAYIDKVRQLESENSGLRREIQTTQEVV---TREVSNIKGMYEHELQDARKLLDDTSRE 454 L Y + + ++ENS LRRE ++ + T + + E ++ RKL D SRE Sbjct: 477 LIHYAQQQARRDAENSALRREKNDLEDDLRDCTLREAKTRDQCETLKEEIRKLERDRSRE 536 Query: 455 KAKLE 469 A LE Sbjct: 537 TANLE 541 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 4/74 (5%) Frame = +2 Query: 257 DALQN-LNDR---LAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDA 424 DAL+ + DR + +K+ LE +NS ++ E + T+E + + S+++ Sbjct: 2373 DALKKEIRDRDKSIGELTEKIETLEKDNSSVQSEYKETKEKLKKRSSSLQEKLGVSKNFM 2432 Query: 425 RKLLDDTSREKAKL 466 +K+LD+ K ++ Sbjct: 2433 QKILDENEELKGRI 2446 >SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) Length = 552 Score = 29.5 bits (63), Expect = 1.6 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 7/71 (9%) Frame = +2 Query: 296 IDKVRQLESENSG-LRREIQTTQEVVTREVSNIKGMYEHE--LQDARKLLDDTSRE---- 454 ++ VR ES +G L++E+ E + + +I+ + E E L +K L++ +E Sbjct: 7 LEGVRHEESTRAGDLQKEVTQASENIEKYSQSIRDLGEKENVLTSEKKQLEEECQENIKQ 66 Query: 455 KAKLEIDLKRL 487 + KLE+D+K L Sbjct: 67 RTKLELDIKDL 77 >SB_12264| Best HMM Match : Filament (HMM E-Value=0.0075) Length = 762 Score = 29.5 bits (63), Expect = 1.6 Identities = 20/75 (26%), Positives = 33/75 (44%) Frame = +2 Query: 263 LQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKLLDD 442 L+ L + + + E S LR+ + + ++ + N K EHEL AR +DD Sbjct: 508 LEELREEHVKLLSSSEYADLERSQLRKRLSDLEGLMAT-LKNEKESLEHELGSARGRIDD 566 Query: 443 TSREKAKLEIDLKRL 487 +K L L+ L Sbjct: 567 LETKKNLLTEQLEIL 581 >SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) Length = 1491 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +2 Query: 293 YIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKLLDDTSRE 454 Y DK+ LE+EN L +I + +E + +K +E E + LD E Sbjct: 1239 YEDKIASLEAENEALMEDIFVLKTRYRQEKAMMKAEFETERNALEERLDQEREE 1292 >SB_2495| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.2e-11) Length = 2024 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +2 Query: 308 RQLESENSGLRREIQTTQEVVTR---EVSNIKGMYEHELQDARKLLDDTSREKA 460 +QLES + G RRE+Q + ++ + E S ++ +E + Q+ L D ++ A Sbjct: 859 QQLESYSDGYRRELQRKEAMIQQLYAEKSKLQSEFERQKQEVYVLQHDFQKQVA 912 >SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1218 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 308 RQLESENSGLRREIQTTQEVVTREVSNIKG-MYEHELQDARKLLDDTSREKAKLE 469 + L+ E L E Q + K + EH +++ KLL + +REKA+LE Sbjct: 205 KSLKEEKYKLEEEFQANVASNEKNFQKWKSEIEEHFMEEKAKLLQNAAREKAELE 259 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 29.1 bits (62), Expect = 2.1 Identities = 19/71 (26%), Positives = 31/71 (43%) Frame = +2 Query: 257 DALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKLL 436 + L+ L DR+A ++ LE + +R+E T E T E +K + +L Sbjct: 51 ERLEELEDRIAKLEEERDNLEVQLETVRKENDTEMEKQTNENDTLKETITGHEETIEQLK 110 Query: 437 DDTSREKAKLE 469 + KA LE Sbjct: 111 SEIEEIKADLE 121 >SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3511 Score = 28.7 bits (61), Expect = 2.7 Identities = 15/63 (23%), Positives = 37/63 (58%), Gaps = 3/63 (4%) Frame = +2 Query: 230 YQAK-PFAREDALQNLNDRLAAYIDKVRQLESENSGLRR--EIQTTQEVVTREVSNIKGM 400 +Q+K PF+ ++ +++ Y ++V L+S+ + LRR I ++ +++++ N++ Sbjct: 513 FQSKGPFSSSIGVKEALEQVTQYHEQVVNLKSQETSLRRGLNIFKIEQALSKDLQNLEKD 572 Query: 401 YEH 409 EH Sbjct: 573 LEH 575 >SB_16761| Best HMM Match : PDZ (HMM E-Value=1.6e-08) Length = 889 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = +2 Query: 299 DKVRQLESENSGLRREIQ---TTQEVVTREVSNIKGMYEHELQDARKLLDDTSREKAK 463 DK +E EN +R++++ T +V RE+ N+K M Q++ KLL++ +++ Sbjct: 3 DKYGAIE-ENRKMRQDLKDATTKLQVAEREIENLKTMLGECSQESVKLLEEVEEVRSR 59 >SB_16649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 483 Score = 28.7 bits (61), Expect = 2.7 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 296 IDKVRQLESENSGLRREIQTTQEV 367 +DK+R LE EN+ LR+E+ +++ Sbjct: 171 VDKIRHLEKENTRLRQEVDNLRKM 194 >SB_9721| Best HMM Match : Filament (HMM E-Value=0.2) Length = 216 Score = 28.7 bits (61), Expect = 2.7 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 3/75 (4%) Frame = +2 Query: 266 QNLNDRLAAYIDKV-RQLESENSGLRREIQTTQEVVTR-EVSNIKGMYEHE-LQDARKLL 436 ++L D++ Y+D RQL E L+ + ++ + E K E+E L+ A + Sbjct: 117 KSLEDKII-YLDATKRQLPKEKDELKSRVDHLEDSIGDFETEKAKLFTENEELRLANLEI 175 Query: 437 DDTSREKAKLEIDLK 481 D RE+ KLE ++K Sbjct: 176 QDVYRERGKLEAEIK 190 >SB_48940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 298 Score = 28.7 bits (61), Expect = 2.7 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +2 Query: 257 DALQNLNDRLAAYIDKVRQLES---ENSGLRREIQTTQEVVTREVSNIKGMYEHELQDAR 427 D + +L R + D V LE + L REI+ VV++E+ + K E+QD+ Sbjct: 68 DEIDDLKTRPSGATDYVALLEEWKKADVNLLREIRDVGNVVSKEIKDSKKSISKEIQDSV 127 Query: 428 K 430 K Sbjct: 128 K 128 >SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) Length = 1447 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/71 (25%), Positives = 34/71 (47%) Frame = +2 Query: 269 NLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKLLDDTS 448 NL LAAYI + + L ++ L ++QT + R + ++ E ++ D L+ +S Sbjct: 775 NLARELAAYITREKNLARQSDDLSLQVQTL-DAEKRSLQSLVSSQEKQVADLSVKLEKSS 833 Query: 449 REKAKLEIDLK 481 +E L+ Sbjct: 834 ERCRLMEQQLQ 844 >SB_35536| Best HMM Match : zf-C2H2 (HMM E-Value=0.0069) Length = 657 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/88 (20%), Positives = 38/88 (43%) Frame = +2 Query: 203 RSSKQST*SYQAKPFAREDALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREV 382 +S+K +YQ + E+ L L ++ QLE E ++ E++ T+E++ E+ Sbjct: 208 KSTKDELFTYQKRRNEYEEKLNALLEKEKIVEMTTLQLEDEKEKIKNELEETKELMQAEL 267 Query: 383 SNIKGMYEHELQDARKLLDDTSREKAKL 466 + Y + + L + + L Sbjct: 268 ESQAETYTEQTRKMHSELQEGRAREGSL 295 >SB_33073| Best HMM Match : Protamine_P1 (HMM E-Value=1.5) Length = 537 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +3 Query: 258 MHYKISTTGWLPISIKYASWRVRIRDYVVKYKPHR-RWSPARFPTLKECTSMNSK 419 + Y+ + PI+++Y VR R V+Y+P R+ P L E T+ SK Sbjct: 481 VRYRPIAVRYRPIAVRYRPIAVRYRPIAVRYRPIAVRYRPIAENGLVERTTRQSK 535 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 258 MHYKISTTGWLPISIKYASWRVRIRDYVVKYKP 356 + Y+ S + PI+++Y VR R V+Y+P Sbjct: 460 VRYRPSAVRYRPIAVRYRPIAVRYRPIAVRYRP 492 >SB_30233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 807 Score = 28.7 bits (61), Expect = 2.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 88 LVGYIFVTITNFDTQ*CIFHTKGE 17 L+GY+F+ ++N + C H KGE Sbjct: 567 LIGYVFMMLSNTNIHQCFQHCKGE 590 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 28.7 bits (61), Expect = 2.7 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +2 Query: 248 AREDALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSN 388 A E L D + D+ LE +N GL RE++T + V+ ++N Sbjct: 432 ALERDLSTRTDMVRKLRDEKSALEKKNEGLIRELETNKRFVSTALNN 478 >SB_7846| Best HMM Match : CoCoA (HMM E-Value=0.00016) Length = 1284 Score = 28.7 bits (61), Expect = 2.7 Identities = 21/77 (27%), Positives = 38/77 (49%) Frame = +2 Query: 254 EDALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKL 433 E+++ +L +++ +V ++ + + QT + +S I + E +LQ A K Sbjct: 1126 EESVSSLMRQMSQLQLEVEVRDTRLAEIEHLFQTEKADKQNLISEIMNLQE-QLQKAEKD 1184 Query: 434 LDDTSREKAKLEIDLKR 484 + E AKLE DLKR Sbjct: 1185 EETRKEEVAKLECDLKR 1201 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 28.3 bits (60), Expect = 3.6 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 3/80 (3%) Frame = +2 Query: 257 DALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGM---YEHELQDAR 427 D L N+ L KV +LE E L E++ ++ + ++ ++ + Sbjct: 716 DELMKQNESLRK---KVSKLEDEVRFLNDELREADSSSIKDTEKLNAEIREFKKKIVELE 772 Query: 428 KLLDDTSREKAKLEIDLKRL 487 KL+DD E KLE +LK + Sbjct: 773 KLVDDQEEEIKKLEDELKNV 792 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 3/60 (5%) Frame = +2 Query: 299 DKVRQLESENSGLRREIQTTQE---VVTREVSNIKGMYEHELQDARKLLDDTSREKAKLE 469 DKV QLE E + LR + + ++ + +E+ +K +L+ A + DD ++E +LE Sbjct: 820 DKVAQLEKELANLRTKYKVIEDRDGMKQKEIDQLKA----DLEAAMEKADDLAKEVQRLE 875 >SB_37872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/75 (24%), Positives = 37/75 (49%) Frame = +2 Query: 263 LQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKLLDD 442 L ++ LA +++ + E++ + Q +++ + NI+ + + R LD+ Sbjct: 164 LDSVRAELATMSERLESEQKEHAQAEAKTQKSEQFLR----NIEAKSKQVIIALRGQLDE 219 Query: 443 TSREKAKLEIDLKRL 487 S EK KLE ++ RL Sbjct: 220 ASEEKVKLEEEVNRL 234 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/52 (36%), Positives = 26/52 (50%) Frame = +2 Query: 299 DKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKLLDDTSRE 454 DKV LE E LR I+ + + + V + YE+EL D+RK D E Sbjct: 3405 DKV-SLEKEQWELREAIEELRATL-KGVEEERDRYENELDDSRKQYPDAKDE 3454 >SB_10610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 594 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 282 GWLPISIKYASWRVRIRDYVVKYKPHRRWSPARFPTLKECT 404 GW+ ++ RVR+ D +V+ PH A PT+ + T Sbjct: 463 GWITNAVYTGISRVRLADQIVRVIPHDDTPGALVPTVLQAT 503 >SB_1658| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.16) Length = 458 Score = 28.3 bits (60), Expect = 3.6 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +2 Query: 299 DKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKLLDDTSRE 454 D+V LE EN LR+E+ + E + ++ K E Q+ + LD ++ Sbjct: 19 DRVSNLELENKLLRKEVSSLNEEMVSQLQRAKDA-EKRAQETDRHLDHAQQQ 69 >SB_49818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 27.9 bits (59), Expect = 4.7 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +2 Query: 344 EIQTTQEVVTREVSNIKGMYEHELQDARKLLDDTSREKAKLE 469 EI T E + R +++K + EH ++D LDD S EK E Sbjct: 35 EICTALEKIGR--NDVKQVIEHHIKDRDCYLDDDSIEKVSFE 74 >SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) Length = 2155 Score = 27.9 bits (59), Expect = 4.7 Identities = 17/84 (20%), Positives = 37/84 (44%) Frame = +2 Query: 233 QAKPFAREDALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHE 412 +AK +E +Q++ D I++++ E + +E++ ++ K YE Sbjct: 95 EAKLQEKELDVQSVRDAKDRNIEELKAKLQEREAMLESANEGEELLKSQLEAAKQFYESA 154 Query: 413 LQDARKLLDDTSREKAKLEIDLKR 484 +D LDD + +L+ L + Sbjct: 155 SRDLNVTLDDLRSKNEQLQRQLSQ 178 >SB_40853| Best HMM Match : BTB (HMM E-Value=1.4e-17) Length = 259 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 302 KVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHE 412 KV LE + + +R+EI+ T E RE+S + +H+ Sbjct: 175 KVATLEQKPNSIRKEIKETCEWAIREISRVVFHKKHQ 211 >SB_20162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 842 Score = 27.9 bits (59), Expect = 4.7 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 3/65 (4%) Frame = +2 Query: 293 YIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKLLDDTSREK---AK 463 Y ++++ +E EN+GL+ E + + + +TR I+ + + +K ++T R + Sbjct: 54 YEERLQSMEMENAGLKDEKRHSSQQITRSEQAIQQLNKDMSSLKQKHRNETLRSEETIQN 113 Query: 464 LEIDL 478 LEI+L Sbjct: 114 LEIEL 118 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/46 (28%), Positives = 27/46 (58%) Frame = +2 Query: 332 GLRREIQTTQEVVTREVSNIKGMYEHELQDARKLLDDTSREKAKLE 469 GLRRE+ + E+V+ + IK + E E+ D + +++ + ++E Sbjct: 1203 GLRRELGRSMEMVSAKAERIKKL-EAEVADLQSMVEQDRQRAERME 1247 >SB_41916| Best HMM Match : DUF164 (HMM E-Value=0.8) Length = 391 Score = 27.5 bits (58), Expect = 6.3 Identities = 19/80 (23%), Positives = 41/80 (51%), Gaps = 8/80 (10%) Frame = +2 Query: 257 DALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYE------HELQ 418 D Q L +++ A +DK + + L+ ++ T Q + + ++ +GM E ++Q Sbjct: 135 DEKQRLEEQMRAVMDKYKYKRRQIRELQEDLGTMQVTLDKLTADEQGMVEVIDEKQQKMQ 194 Query: 419 DARKLLDDT--SREKAKLEI 472 + ++ LDD RE+A ++ Sbjct: 195 NLQRELDDQKGKRERAGKQV 214 >SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) Length = 1312 Score = 27.5 bits (58), Expect = 6.3 Identities = 17/75 (22%), Positives = 37/75 (49%) Frame = +2 Query: 254 EDALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKL 433 +D L L DK+R+L+ E S +RE T + + +E ++++ + + D K Sbjct: 921 QDFLGKLEKAKVPLEDKIRELKEELSKAKREQNTAKSALEQEKADLQQEVD-RVNDNMKA 979 Query: 434 LDDTSREKAKLEIDL 478 ++++ + + DL Sbjct: 980 KLQRAKDEIERQADL 994 >SB_21939| Best HMM Match : F-box (HMM E-Value=0.001) Length = 909 Score = 27.5 bits (58), Expect = 6.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 178 TGVLDCSGLCSDDTTLAFDEDVTVF 104 TG + +G+C DD++ DED +F Sbjct: 830 TGSIHVTGVCQDDSSSTSDEDSNMF 854 >SB_39125| Best HMM Match : DUF164 (HMM E-Value=0.082) Length = 363 Score = 27.5 bits (58), Expect = 6.3 Identities = 17/75 (22%), Positives = 37/75 (49%) Frame = +2 Query: 254 EDALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKL 433 +D L L DK+R+L+ E S +RE T + + +E ++++ + + D K Sbjct: 201 QDFLGKLEKAKVPLEDKIRELKEELSKAKREQNTAKSALEQEKADLQQEVD-RVNDNMKA 259 Query: 434 LDDTSREKAKLEIDL 478 ++++ + + DL Sbjct: 260 KLQRAKDEIERQADL 274 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 27.5 bits (58), Expect = 6.3 Identities = 23/89 (25%), Positives = 46/89 (51%) Frame = +2 Query: 212 KQST*SYQAKPFAREDALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNI 391 KQS+ ++ AR +N N ++ + VR + G RR Q + ++ +E Sbjct: 1938 KQSSLAFLEHRTARS---RNENIKILRILSGVRIIGPAVRGSRRR-QPCEPMLEQETME- 1992 Query: 392 KGMYEHELQDARKLLDDTSREKAKLEIDL 478 + E +LQ+ ++ LD+ ++K +LE++L Sbjct: 1993 RMRLEVQLQEIQESLDEIKKKKDQLEVEL 2021 >SB_12753| Best HMM Match : M (HMM E-Value=0.0006) Length = 304 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/54 (20%), Positives = 27/54 (50%) Frame = +2 Query: 254 EDALQNLNDRLAAYIDKVRQLESENSGLRREIQTTQEVVTREVSNIKGMYEHEL 415 +D + +L ++A + + ++LE+EN + E + + ++ + EH L Sbjct: 108 QDQITSLKSQIACIVSEKKKLETENQNIYLEREMLSKGSKEKIEELSTQLEHVL 161 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +2 Query: 317 ESENSGLRREIQTTQEVVTREVSNIKGMYEHE--LQDARKLLDDTSREKAKLE 469 E+EN LR E++ V R +K +HE L+D L ++K +LE Sbjct: 165 ETENVSLRNEVRYLHGEVKRLEEQLKAETQHESTLRDLSSQLATAVQQKEELE 217 >SB_27760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 273 STTGWLPISIKYASWRVRIRDYVVKYKPHRRWSPARFPTLKECT 404 S GW+ ++ RVR+ D +V+ PH A PT + T Sbjct: 104 SLEGWITNAVYTGISRVRLADQIVRVIPHDDTPGALVPTGLQAT 147 >SB_17486| Best HMM Match : CheR (HMM E-Value=3.2) Length = 1177 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 273 STTGWLPISIKYASWRVRIRDYVVKYKPHRRWSPARFPTLKECT 404 S GW+ ++ RVR+ D +V+ PH A PT + T Sbjct: 1075 SLEGWITNAVYTGISRVRLADQIVRVIPHDDTPGALVPTGLQAT 1118 >SB_4107| Best HMM Match : M (HMM E-Value=8e-22) Length = 2039 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = +2 Query: 317 ESENSGLRREIQTTQEVVTREVSNIKGMYEHELQDARKLLDDTSREKAKLEID 475 E EN L R+IQ Q+ + E E ARKL++ TSR + ++E++ Sbjct: 1843 EHENQELHRQIQILQQQLA----------ETEQSHARKLVEVTSRHRQEIEME 1885 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,330,491 Number of Sequences: 59808 Number of extensions: 287529 Number of successful extensions: 1238 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 1043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1229 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -