BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0668 (758 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protei... 23 3.5 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 3.5 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 3.5 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 6.1 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 6.1 >L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protein protein. Length = 74 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 460 RPHHVQGPRKHVVGERPSALEHALKLESDVTN 555 R HH++ + GERP EH + V N Sbjct: 21 RDHHLKTHMRLHTGERPYRCEHCDRQFVQVAN 52 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/49 (24%), Positives = 22/49 (44%) Frame = -2 Query: 406 RVLAFFSRSIEE*FAKPGRFTVSIEK*APMAKYWIDAATSSWICFLIML 260 RVL + + F+ P F ++ M + WID T W ++ ++ Sbjct: 162 RVLVMLAWLLSILFSLPTVFLFEEKQVQSMPQCWIDLQTWQWKVYITLV 210 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 460 RPHHVQGPRKHVVGERPSALEHALKLESDVTN 555 R HH++ + GERP EH + V N Sbjct: 174 RDHHLKTHMRLHTGERPYRCEHCDRQFVQVAN 205 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -2 Query: 691 LEGRALPARSRWPLYCS 641 L R L A + WP++C+ Sbjct: 607 LVARGLGAEAMWPVWCA 623 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -2 Query: 691 LEGRALPARSRWPLYCS 641 L+ R + + WPL+CS Sbjct: 560 LKSRGIRTAAIWPLWCS 576 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,866 Number of Sequences: 336 Number of extensions: 3042 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -