BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0663 (455 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI000049900E Cluster: hypothetical protein 146.t00007;... 36 0.55 >UniRef50_UPI000049900E Cluster: hypothetical protein 146.t00007; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 146.t00007 - Entamoeba histolytica HM-1:IMSS Length = 333 Score = 35.5 bits (78), Expect = 0.55 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -1 Query: 455 LFIYKKKHNYALYCRNRNN-IKHFVSWLKSLSQD 357 LF++K HNY L+C R+N I F W +S + D Sbjct: 280 LFLFKLYHNYILFCSTRHNLINSFFKWFESDAPD 313 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 320,164,171 Number of Sequences: 1657284 Number of extensions: 4898857 Number of successful extensions: 11128 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 10623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11121 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 23931581955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -