Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0663
         (455 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI000049900E Cluster: hypothetical protein 146.t00007;...    36   0.55 

>UniRef50_UPI000049900E Cluster: hypothetical protein 146.t00007;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 146.t00007 - Entamoeba histolytica HM-1:IMSS
          Length = 333

 Score = 35.5 bits (78), Expect = 0.55
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%)
 Frame = -1

Query: 455 LFIYKKKHNYALYCRNRNN-IKHFVSWLKSLSQD 357
           LF++K  HNY L+C  R+N I  F  W +S + D
Sbjct: 280 LFLFKLYHNYILFCSTRHNLINSFFKWFESDAPD 313


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 320,164,171
Number of Sequences: 1657284
Number of extensions: 4898857
Number of successful extensions: 11128
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 10623
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11121
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 23931581955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)