BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0654 (686 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g51490.1 68418.m06386 pectinesterase family protein contains ... 29 2.9 At5g57390.1 68418.m07170 ovule development protein, putative sim... 28 5.0 At5g24880.1 68418.m02946 expressed protein ; expression supporte... 28 5.0 At1g09620.1 68414.m01079 tRNA synthetase class I (I, L, M and V)... 28 5.0 At5g51500.1 68418.m06387 pectinesterase family protein contains ... 28 6.7 At2g37360.1 68415.m04582 ABC transporter family protein 27 8.8 >At5g51490.1 68418.m06386 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 536 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 64 RKFDLSKFYIYFYY-IVTNNITRRMSTETLIAAGDGVRENLVT 189 RK +F IY I NI R++ + ++ GDG+R ++T Sbjct: 245 RKVTSGRFVIYVKRGIYQENINVRLNNDDIMLVGDGMRSTIIT 287 >At5g57390.1 68418.m07170 ovule development protein, putative similar to ovule development protein AINTEGUMENTA (GI:1209099)[Arabidopsis thaliana] Length = 555 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 593 TCFAGGNSIRPSVRRHWYSNLLDFSEPPQAFVRSLA 486 T + G I+P H++SN+ F P+A +R LA Sbjct: 423 TFYHTGIPIKPDPADHYWSNIFGFQANPKAEMRPLA 458 >At5g24880.1 68418.m02946 expressed protein ; expression supported by MPSS Length = 443 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = +3 Query: 165 RSTRKFGNNSSEFPDKPKRAKVHSRKQRTILRSKGLTDTEIQKALEKCMNLVEFPSMSS 341 R+ K GN + P PK++ ++S + + +G + I+KA +K + L + SMSS Sbjct: 139 RNVPKGGNTAKSPPVAPKKSGLNSSSTSSKSKKEGSENVRIKKASDKEIAL-DSASMSS 196 >At1g09620.1 68414.m01079 tRNA synthetase class I (I, L, M and V) family protein similar to cytosolic leucyl-tRNA synthetase [Candida albicans] GI:9858190; contains Pfam profile PF00133: tRNA synthetases class I (I, L, M and V) Length = 1084 Score = 28.3 bits (60), Expect = 5.0 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Frame = +3 Query: 210 KPKRAKVHSRK-----QRTILRSKGLTDTEIQKALEKCMNLVEFPSMSSELMFFHQSRSS 374 K K++KV ++ Q I+RS GLTD+EI E L FP ++ E + + Sbjct: 145 KGKKSKVAAKAGGQVYQWEIMRSFGLTDSEIANFREPSEWLYYFPPLAVEDLRAYGLGCD 204 Query: 375 WFRDHV 392 W R V Sbjct: 205 WRRSFV 210 >At5g51500.1 68418.m06387 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 540 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 64 RKFDLSKFYIYFYY-IVTNNITRRMSTETLIAAGDGVRENLVT 189 RK +F IY I N+ R++ + ++ GDG+R ++T Sbjct: 249 RKVTSGRFVIYVKRGIYQENLNVRLNNDNIMLVGDGMRYTIIT 291 >At2g37360.1 68415.m04582 ABC transporter family protein Length = 755 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 129 KNEYRNFNRCWGRSTRKFGNNS-SEFPDKPK 218 +NE++N RC+ R + F N+ EFP+ K Sbjct: 656 QNEFQNPTRCFARGVQLFDNSPLGEFPNDVK 686 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,049,655 Number of Sequences: 28952 Number of extensions: 278003 Number of successful extensions: 829 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 829 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -