BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0652 (470 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14472| Best HMM Match : No HMM Matches (HMM E-Value=.) 119 1e-27 SB_58028| Best HMM Match : zf-C4 (HMM E-Value=0) 82 2e-16 SB_12318| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_10105| Best HMM Match : zf-C4 (HMM E-Value=3.60001e-40) 59 2e-09 SB_33135| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_58027| Best HMM Match : zf-C4 (HMM E-Value=0) 56 1e-08 SB_32228| Best HMM Match : zf-C4 (HMM E-Value=6.2e-23) 56 1e-08 SB_56305| Best HMM Match : zf-C4 (HMM E-Value=0) 56 1e-08 SB_18088| Best HMM Match : zf-C4 (HMM E-Value=7.56701e-44) 56 2e-08 SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) 55 3e-08 SB_30131| Best HMM Match : zf-C4 (HMM E-Value=8.39938e-42) 54 5e-08 SB_4250| Best HMM Match : zf-C4 (HMM E-Value=2.3e-39) 53 1e-07 SB_12110| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) 50 1e-06 SB_5770| Best HMM Match : Hormone_recep (HMM E-Value=3.4e-22) 48 3e-06 SB_9970| Best HMM Match : zf-C4 (HMM E-Value=9.4e-38) 46 2e-05 SB_58064| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_36879| Best HMM Match : Hormone_recep (HMM E-Value=0) 38 0.003 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 33 0.16 SB_11498| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_5110| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_30569| Best HMM Match : 3-alpha (HMM E-Value=6) 30 1.1 SB_56020| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 2.6 SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 4.5 SB_40929| Best HMM Match : Attractin (HMM E-Value=5.1) 28 4.5 SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_44753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_31180| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_12550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_58730| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_23024| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 >SB_14472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 119 bits (287), Expect = 1e-27 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 1/73 (1%) Frame = +1 Query: 253 YPASRYSPCVQ-PTNVMGIDNICELAARLLFSAVEWARNIPFFPELQVTDQVALLRLVWS 429 YP +R+ + P +MGI+NICELAARLLFSAVEWARNIPFFP+L VTDQVALLRLVWS Sbjct: 358 YPTTRFQQGLNMPCGIMGIENICELAARLLFSAVEWARNIPFFPDLAVTDQVALLRLVWS 417 Query: 430 ELFVLNASKCSMP 468 ELFVLNA++C MP Sbjct: 418 ELFVLNAAQCPMP 430 Score = 100 bits (240), Expect = 5e-22 Identities = 47/83 (56%), Positives = 56/83 (67%) Frame = +3 Query: 3 SCRGNRSCPIDQHHRNQCQFCRLRKCLKMGMRREAVQRGRVXXXXXXXXXXXXXFTLGNG 182 +CR +R CPIDQHHRNQCQ+CRL+KCLK+GMRREAVQRGR+ G+G Sbjct: 278 TCRASRDCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRIPAAQTPTQNAALPGINGDG 337 Query: 183 DPGAGLNNHPYLSSYISLLLRAE 251 N H YLS +I+LLLRAE Sbjct: 338 ----STNGHSYLSGFIALLLRAE 356 >SB_58028| Best HMM Match : zf-C4 (HMM E-Value=0) Length = 438 Score = 82.2 bits (194), Expect = 2e-16 Identities = 40/83 (48%), Positives = 53/83 (63%) Frame = +3 Query: 3 SCRGNRSCPIDQHHRNQCQFCRLRKCLKMGMRREAVQRGRVXXXXXXXXXXXXXFTLGNG 182 SCRG R+CP+D +RNQCQ+CRL+KCLK+GMR+EAVQ+GR+ NG Sbjct: 114 SCRGVRNCPVDIQNRNQCQYCRLKKCLKVGMRKEAVQKGRIPSTHPDVGPLSVSMVEMNG 173 Query: 183 DPGAGLNNHPYLSSYISLLLRAE 251 + + SSYI+LLLRA+ Sbjct: 174 -------HQSFYSSYITLLLRAD 189 Score = 79.8 bits (188), Expect = 1e-15 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 2/74 (2%) Frame = +1 Query: 247 RSYPASRYSPCVQ-PTNVMGIDNICELAARLLFSAVEWARNIPFFPELQVTDQVALLRLV 423 R+ +RY + P N+ G++N ELAARLL SAVEWA+NIPF+ +L + DQ LLR Sbjct: 187 RADTIARYQQSLTLPCNINGLENTPELAARLLVSAVEWAKNIPFYSDLPLPDQAVLLRSC 246 Query: 424 WSELFVLNASK-CS 462 WSELF LNA++ CS Sbjct: 247 WSELFTLNAAQHCS 260 >SB_12318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 420 Score = 59.3 bits (137), Expect = 2e-09 Identities = 28/54 (51%), Positives = 38/54 (70%) Frame = +1 Query: 307 DNICELAARLLFSAVEWARNIPFFPELQVTDQVALLRLVWSELFVLNASKCSMP 468 D+I E A +LL+ +V WARNIP F +L DQ LL WSELFVL++++ S+P Sbjct: 227 DSIYESAVQLLYMSVTWARNIPTFLDLPFRDQAILLEEGWSELFVLSSAQFSLP 280 >SB_10105| Best HMM Match : zf-C4 (HMM E-Value=3.60001e-40) Length = 370 Score = 59.3 bits (137), Expect = 2e-09 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = +3 Query: 6 CRGNRSCPIDQHHRNQCQFCRLRKCLKMGMRREAVQRGR 122 C G+ SC +D+ +R QCQ CR +KC +GMRREA++RGR Sbjct: 58 CEGSGSCRVDKQNRTQCQACRFKKCATVGMRREAIRRGR 96 Score = 41.9 bits (94), Expect = 3e-04 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 1/113 (0%) Frame = +1 Query: 121 ECLHRSRPAWDSLASSP*ATVTPAPDS-TIIHISRRTYRCYCGRSYPASRYSPCVQPTNV 297 E + R RP S S + TP D +++ R+ R YP+S +Q + V Sbjct: 90 EAIRRGRPTKYSYISRSSKSFTPQYDLISVLTQLERSIRPPV--PYPSSG----LQSSPV 143 Query: 298 MGIDNICELAARLLFSAVEWARNIPFFPELQVTDQVALLRLVWSELFVLNASK 456 +C + L S ++W+R +P F L V +Q ++LR W E+ +++A++ Sbjct: 144 SMYHRVCSI----LVSTLDWSRRVPMFANLDVCEQYSVLRSRWCEMLIVSAAQ 192 >SB_33135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 58.4 bits (135), Expect = 3e-09 Identities = 21/33 (63%), Positives = 29/33 (87%) Frame = +3 Query: 24 CPIDQHHRNQCQFCRLRKCLKMGMRREAVQRGR 122 CP+++ +RN CQFCR+RKCL +GM+REAVQ+ R Sbjct: 66 CPVNKRYRNSCQFCRMRKCLAVGMKREAVQQAR 98 Score = 54.4 bits (125), Expect = 5e-08 Identities = 24/50 (48%), Positives = 33/50 (66%) Frame = +1 Query: 319 ELAARLLFSAVEWARNIPFFPELQVTDQVALLRLVWSELFVLNASKCSMP 468 E+AARLLF WA+ + F EL DQV LLR WS++F++N + +MP Sbjct: 173 EMAARLLFMTAHWAKKVKHFSELSHFDQVTLLRENWSKVFIINLVQWAMP 222 >SB_58027| Best HMM Match : zf-C4 (HMM E-Value=0) Length = 396 Score = 56.4 bits (130), Expect = 1e-08 Identities = 25/57 (43%), Positives = 37/57 (64%) Frame = +1 Query: 286 PTNVMGIDNICELAARLLFSAVEWARNIPFFPELQVTDQVALLRLVWSELFVLNASK 456 P N D ELAA +LF+ V+WAR + F L +DQ+ LL++ W++LF+L AS+ Sbjct: 176 PLNQNRTDVAYELAANVLFAVVDWARKLTTFNNLMDSDQITLLKMAWTDLFLLEASR 232 Score = 52.0 bits (119), Expect = 2e-07 Identities = 19/37 (51%), Positives = 28/37 (75%) Frame = +3 Query: 3 SCRGNRSCPIDQHHRNQCQFCRLRKCLKMGMRREAVQ 113 +CRG +C ID++ R++C CR +KCL GM++EAVQ Sbjct: 92 TCRGQNTCAIDRNSRSRCPSCRFQKCLSTGMKKEAVQ 128 >SB_32228| Best HMM Match : zf-C4 (HMM E-Value=6.2e-23) Length = 300 Score = 56.4 bits (130), Expect = 1e-08 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = +3 Query: 6 CRGNRSCPIDQHHRNQCQFCRLRKCLKMGMRREAVQRGR 122 C+ CPID RNQCQ CRLRKC +M M R+AVQ R Sbjct: 22 CKEKNDCPIDVARRNQCQACRLRKCFEMNMNRDAVQHER 60 Score = 50.8 bits (116), Expect = 6e-07 Identities = 24/53 (45%), Positives = 33/53 (62%) Frame = +1 Query: 295 VMGIDNICELAARLLFSAVEWARNIPFFPELQVTDQVALLRLVWSELFVLNAS 453 V+ +D + E A R+L+ V+W RNIP F +L DQ L+ WSELFVL + Sbjct: 145 VVYMDMMYESAIRVLYMTVKWVRNIPTFLDLPFRDQAILIEESWSELFVLRTA 197 >SB_56305| Best HMM Match : zf-C4 (HMM E-Value=0) Length = 553 Score = 56.0 bits (129), Expect = 1e-08 Identities = 21/41 (51%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = +3 Query: 3 SCRG-NRSCPIDQHHRNQCQFCRLRKCLKMGMRREAVQRGR 122 +CR + CPID+ HRN+CQ+CR +KC++ GM +EAV+ R Sbjct: 233 TCRNLTKDCPIDKRHRNRCQYCRFQKCIQAGMIKEAVREDR 273 >SB_18088| Best HMM Match : zf-C4 (HMM E-Value=7.56701e-44) Length = 1220 Score = 55.6 bits (128), Expect = 2e-08 Identities = 19/36 (52%), Positives = 28/36 (77%) Frame = +3 Query: 3 SCRGNRSCPIDQHHRNQCQFCRLRKCLKMGMRREAV 110 +CRGN+ C I+QH RN+CQ+CR KC+K GM ++ + Sbjct: 858 TCRGNQDCDINQHTRNRCQYCRFEKCVKSGMLKQGM 893 >SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) Length = 405 Score = 54.8 bits (126), Expect = 3e-08 Identities = 25/63 (39%), Positives = 41/63 (65%) Frame = +1 Query: 280 VQPTNVMGIDNICELAARLLFSAVEWARNIPFFPELQVTDQVALLRLVWSELFVLNASKC 459 V+P + + +NI + A RLL +++ +ARN+P F L DQ+ LL W ELF+L+A+ Sbjct: 207 VEPIHFIVSENIQDAATRLLSASIRFARNVPCFTRLPFRDQIILLEEGWKELFLLDAAYW 266 Query: 460 SMP 468 ++P Sbjct: 267 ALP 269 Score = 39.1 bits (87), Expect = 0.002 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = +3 Query: 6 CRGNRSCPIDQHHRNQCQFCRLRKCLKMGMR 98 C+ +C + RN+C+ CR++KC+++GM+ Sbjct: 60 CKAQNACSVKTTSRNECKACRMKKCVEVGMK 90 >SB_30131| Best HMM Match : zf-C4 (HMM E-Value=8.39938e-42) Length = 311 Score = 54.4 bits (125), Expect = 5e-08 Identities = 21/40 (52%), Positives = 29/40 (72%) Frame = +3 Query: 3 SCRGNRSCPIDQHHRNQCQFCRLRKCLKMGMRREAVQRGR 122 +C+GN C +D+ RNQCQ CR +KCL++ M R AVQ+ R Sbjct: 70 TCKGNGGCTVDKKRRNQCQACRFKKCLEVKMNRFAVQQER 109 >SB_4250| Best HMM Match : zf-C4 (HMM E-Value=2.3e-39) Length = 79 Score = 53.2 bits (122), Expect = 1e-07 Identities = 20/34 (58%), Positives = 27/34 (79%) Frame = +3 Query: 3 SCRGNRSCPIDQHHRNQCQFCRLRKCLKMGMRRE 104 SCR R+C I++ RNQC+FCRLRKC + GM++E Sbjct: 45 SCRFQRNCVINKDKRNQCRFCRLRKCFRAGMKKE 78 >SB_12110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 50.8 bits (116), Expect = 6e-07 Identities = 19/40 (47%), Positives = 31/40 (77%) Frame = +3 Query: 3 SCRGNRSCPIDQHHRNQCQFCRLRKCLKMGMRREAVQRGR 122 +C ++SC ID+++R +CQ+CR +KCL +GM +EAV+ R Sbjct: 49 ACVESKSCQIDKNNRIRCQYCRFQKCLALGMLKEAVREDR 88 Score = 32.3 bits (70), Expect = 0.21 Identities = 15/55 (27%), Positives = 29/55 (52%) Frame = +1 Query: 304 IDNICELAARLLFSAVEWARNIPFFPELQVTDQVALLRLVWSELFVLNASKCSMP 468 ++ I EL + + + WA+ +P F ++ DQ++LL E+ +L + S P Sbjct: 163 VEAIMELTLQEVEHVINWAKRVPGFCDVDKEDQISLLSEGLLEVLILRICQRSTP 217 >SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) Length = 419 Score = 50.0 bits (114), Expect = 1e-06 Identities = 21/61 (34%), Positives = 36/61 (59%) Frame = +1 Query: 274 PCVQPTNVMGIDNICELAARLLFSAVEWARNIPFFPELQVTDQVALLRLVWSELFVLNAS 453 P + V +D + E A RLLF +++W ++I F L DQ+ALL W+++F+L + Sbjct: 260 PSLAGVQVFSMDYVYEFATRLLFVSIDWTQSISAFRALHKCDQIALLCKTWADIFLLGVA 319 Query: 454 K 456 + Sbjct: 320 Q 320 Score = 49.6 bits (113), Expect = 1e-06 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = +3 Query: 3 SCRGNRSCPIDQHHRNQCQFCRLRKCLKMGMRRE 104 +CRG+ C ID+ HRN+CQ CR KCL GM++E Sbjct: 77 TCRGSNDCFIDKVHRNRCQKCRFVKCLTAGMKKE 110 >SB_5770| Best HMM Match : Hormone_recep (HMM E-Value=3.4e-22) Length = 282 Score = 48.4 bits (110), Expect = 3e-06 Identities = 29/72 (40%), Positives = 38/72 (52%) Frame = +1 Query: 250 SYPASRYSPCVQPTNVMGIDNICELAARLLFSAVEWARNIPFFPELQVTDQVALLRLVWS 429 S PAS + +ICE + L VEWA+++P F EL + DQVALLR S Sbjct: 33 SRPASSPPESICLEKEANYSDICESMRQQLLILVEWAKHLPCFCELPLDDQVALLRAHAS 92 Query: 430 ELFVLNASKCSM 465 E VL S+ S+ Sbjct: 93 EHLVLGVSRRSL 104 >SB_9970| Best HMM Match : zf-C4 (HMM E-Value=9.4e-38) Length = 259 Score = 45.6 bits (103), Expect = 2e-05 Identities = 15/31 (48%), Positives = 23/31 (74%) Frame = +3 Query: 12 GNRSCPIDQHHRNQCQFCRLRKCLKMGMRRE 104 G +CP+D+ HRNQC+ CRL+KC + M ++ Sbjct: 49 GKGNCPVDKIHRNQCRSCRLKKCFDVSMNKD 79 Score = 44.0 bits (99), Expect = 6e-05 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +1 Query: 307 DNICELAARLLFSAVEWARNIPFFPELQVTDQ 402 +++CE AA+LLF +V+WARNIP F L DQ Sbjct: 188 ESVCEAAAKLLFMSVKWARNIPSFMSLPFRDQ 219 >SB_58064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1027 Score = 44.0 bits (99), Expect = 6e-05 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = +3 Query: 6 CRGNRSCPIDQHHRNQCQFCRLRKCLKMGMRREAVQRGR 122 C +C +D+ RN+CQ CR+ KCL +GM++ AVQ R Sbjct: 773 CMFRETCIVDKVLRNRCQKCRMDKCLAVGMQKSAVQYER 811 >SB_36879| Best HMM Match : Hormone_recep (HMM E-Value=0) Length = 358 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/40 (42%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = +3 Query: 3 SC-RGNRS-CPIDQHHRNQCQFCRLRKCLKMGMRREAVQR 116 SC R N++ CP+D++ R +CQ CRL++C GM V++ Sbjct: 44 SCVRSNQNQCPMDKNSRAKCQACRLQRCFDAGMVLNGVRK 83 Score = 30.3 bits (65), Expect = 0.84 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 349 VEWARNIPFFPELQVTDQVALLRLVWSELFVLNASKCSMP 468 V+WA+ +P F +L DQ+ LL EL V S+P Sbjct: 177 VDWAKLVPGFKDLCQEDQITLLTAAGMELVVFRVIFRSIP 216 >SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 506 Score = 32.7 bits (71), Expect = 0.16 Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -3 Query: 309 VYAHDVRWLDAWTVSRGGVAPPA---VAAICTTRDM 211 VYAH VR+L AW G APP V C+TRD+ Sbjct: 168 VYAH-VRYLKAWVQGIMGAAPPTPPPVTGECSTRDL 202 >SB_11498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 0.64 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +3 Query: 213 YLSSYISLLLRAELPRLEIQSMRPTNERHGHRQHLRARCQTAFLRRRMGEKHPLLPRT 386 Y + ++L+A +P ++ +RP E++GHR L R + + EK +L +T Sbjct: 63 YRYELVEIMLKAGIPLAKVDVLRPFLEKYGHR--LTTRSHLSEFIPLISEKEKMLIKT 118 >SB_5110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 30.7 bits (66), Expect = 0.64 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +3 Query: 213 YLSSYISLLLRAELPRLEIQSMRPTNERHGHRQHLRARCQTAFLRRRMGEKHPLLPRT 386 Y + ++L+A +P ++ +RP E++GHR L R + + EK +L +T Sbjct: 4 YRYELVEIMLKAGIPLAKVNVLRPFLEKYGHR--LTTRSHLSEFIPLISEKEKMLIKT 59 >SB_30569| Best HMM Match : 3-alpha (HMM E-Value=6) Length = 160 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 213 YLSSYISLLLRAELPRLEIQSMRPTNERHGHR 308 Y + ++L+A +P +I +RP E++GHR Sbjct: 110 YRYELVGIMLKAGIPLAKIDVLRPLLEKYGHR 141 >SB_56020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 309 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +3 Query: 213 YLSSYISLLLRAELPRLEIQSMRPTNERHGHRQHLRARCQTAFLRRRMGEKHPLLPRT 386 Y + +L+A +P ++ +RP E++GHR L R + + EK +L +T Sbjct: 68 YRYELVEKMLKAGIPLAKVDVLRPLLEKYGHR--LTTRSHLSEFIPLISEKENMLIKT 123 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 28.7 bits (61), Expect = 2.6 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 207 HPYLSSYISLL-LRAELPRLEIQSMRPTNERHGHRQHLRARCQTAFLRRRMGEK 365 H ++S + + + P +RP +RH + + ARC+ + RRR G + Sbjct: 7154 HSHISMRVEVYGCYSNAPEASPPKLRPVIKRHRYSVQIVARCRWSIRRRRAGTR 7207 >SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 28.7 bits (61), Expect = 2.6 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +3 Query: 213 YLSSYISLLLRAELPRLEIQSMRPTNERHGHRQHLRARCQTAFLRRRMGEKHPLLPRT 386 Y + ++L+ +P ++ +RP E++GHR L R + + EK +L +T Sbjct: 341 YRYELVEIMLKPGIPLAKVDVLRPFLEKYGHR--LTTRSHLSEFIPLISEKEKMLIKT 396 >SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 426 Score = 27.9 bits (59), Expect = 4.5 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +1 Query: 205 IIHISRRTYRCY-CGRSYPASRY 270 +IH R+ Y+CY CG+ + RY Sbjct: 367 MIHSGRKPYKCYECGKCFSRHRY 389 >SB_40929| Best HMM Match : Attractin (HMM E-Value=5.1) Length = 566 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 371 PSSPNCKLRTKSPY*GSSGRNCSC*TPLSAP 463 PS CK +T +P + R SC T S P Sbjct: 506 PSQARCKTKTSNPQDKQAARQASCKTKTSKP 536 >SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 27.9 bits (59), Expect = 4.5 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +1 Query: 205 IIHISRRTYRCY-CGRSYPASRY 270 +IH R+ Y+CY CG+ + RY Sbjct: 332 MIHSGRKPYKCYECGKCFSRHRY 354 >SB_44753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1379 Score = 27.9 bits (59), Expect = 4.5 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +2 Query: 329 PDCFSPPSNGRETSPSSPNCKLRTKSPY*GSSGRNCSC*TPLSA 460 P+ S P G TS ++P+ LRT SGR +C +P+ A Sbjct: 1313 PNRVSTPKRGSPTSRNTPSRGLRTPVKTAMFSGRCSACASPIRA 1356 >SB_31180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 27.9 bits (59), Expect = 4.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 72 LVCRTDTGFYGAGQWGSSCFLC 7 L C+T GFYG W C +C Sbjct: 20 LRCKTGCGFYGNPAWQGYCSVC 41 >SB_12550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 850 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 167 ELARESQAGRLRWRHSTSLDSFSSHA 90 E AR+ QA + RW +S LD +HA Sbjct: 515 EWARKIQAEKFRWHNSQWLDMIENHA 540 >SB_58730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1014 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 172 RVNWPGSPRPGGCDGGTRPLWTASL 98 R +WP PGG GG W +SL Sbjct: 644 RADWPYGLSPGGLPGGAMFPWESSL 668 >SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 369 DVSRPFDGGEKQSGSELAD 313 D+S PF G KQ+G +LAD Sbjct: 191 DISDPFKKGSKQAGFKLAD 209 >SB_23024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 97 EEKLSKEVECLHRSRPAWDSLASS 168 +EKL KE E ++R R W+S S+ Sbjct: 484 KEKLGKEAEKINRERQQWESETST 507 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,653,198 Number of Sequences: 59808 Number of extensions: 331331 Number of successful extensions: 1065 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1059 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -