BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0636 (626 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) 29 4.1 SB_11560| Best HMM Match : Peptidase_M1 (HMM E-Value=0) 28 5.4 SB_51569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) 27 9.4 >SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) Length = 640 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -3 Query: 432 ELKYLQ-ISLHHTE*NAESMSLYHRLHLCM 346 ELK+ + I +H+ E + SLYH L+LCM Sbjct: 304 ELKHARDIRMHYEEKLERANSLYHELNLCM 333 >SB_11560| Best HMM Match : Peptidase_M1 (HMM E-Value=0) Length = 854 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +1 Query: 274 WVLAWLICDFKFDETIEG 327 ++LA+++CDFK ETI G Sbjct: 319 YLLAFIVCDFKHTETITG 336 >SB_51569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 899 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 395 SVWCRLICKYLSSINICRSL 454 SVW R C+Y SS + C+++ Sbjct: 334 SVWLRFCCRYFSSHSACKAV 353 >SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) Length = 509 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -3 Query: 360 LHLCMYMSPPTSFYCLIKLKITNQPSQHPTKSHQSTSKHL 241 +HL ++MSPP+SF + ++ +S+ S+HL Sbjct: 330 VHLVIFMSPPSSFQSSPSVSSSSLSPPSSFQSYHRPSRHL 369 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,855,504 Number of Sequences: 59808 Number of extensions: 398017 Number of successful extensions: 936 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -