BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0623 (747 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19700| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_6519| Best HMM Match : PNP_UDP_1 (HMM E-Value=0.16) 28 9.2 >SB_19700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 61 FCEYQSRLRNYAKKQRQLVSVVQNLKR 141 F EYQ ++ Y K Q+ +S+V +KR Sbjct: 32 FVEYQKKMDEYHKSQKSCISMVNLIKR 58 >SB_6519| Best HMM Match : PNP_UDP_1 (HMM E-Value=0.16) Length = 238 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 536 RVNLKNVLKYRVSSGKVARFPRRIRSSLRD 625 R N N KY+V GKV +FP + L++ Sbjct: 75 RNNPTNTAKYKVILGKVTKFPASLDDKLKE 104 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,184,981 Number of Sequences: 59808 Number of extensions: 396703 Number of successful extensions: 784 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 770 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -