BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0620 (533 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 22 3.9 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 3.9 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 3.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 9.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.0 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 21.8 bits (44), Expect = 3.9 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +3 Query: 279 MMRFLRSCLYRNKHVPDSAHVSRHL 353 + ++ L + K PD A + RHL Sbjct: 43 LKNYVNCLLEKGKCTPDGAELKRHL 67 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 3.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 442 KDNSASNGSGDFLAALHTQTNMTVVVANGNK 350 K NS +NGS D + ++ + NG+K Sbjct: 279 KPNSTTNGSPDVIKVEPELSDSEKTLCNGSK 309 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 3.9 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 444 LSCQFYQSEEVTGVTR*ESXTPPLQGHR 527 +SC YQ+ E V ES P + R Sbjct: 369 VSCTHYQNPEYISVVNPESPYPQIGSER 396 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.6 bits (41), Expect = 9.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 200 VDFSFANKTAEFGDRN 153 VDF F N +A F D N Sbjct: 82 VDFLFDNFSAAFQDHN 97 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 9.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 200 VDFSFANKTAEFGDRN 153 VDF F N +A F D N Sbjct: 315 VDFLFDNFSAAFQDHN 330 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 9.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 200 VDFSFANKTAEFGDRN 153 VDF F N +A F D N Sbjct: 315 VDFLFDNFSAAFQDHN 330 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,513 Number of Sequences: 336 Number of extensions: 2357 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -