BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0615 (814 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 174 8e-44 SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.48 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 32 0.48 SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033) 30 1.9 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 29 3.4 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 29 4.5 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_52533| Best HMM Match : rve (HMM E-Value=2) 29 4.5 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 29 4.5 SB_22198| Best HMM Match : Borrelia_orfA (HMM E-Value=5.4) 29 4.5 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 4.5 SB_11456| Best HMM Match : 7tm_1 (HMM E-Value=3.5e-40) 29 5.9 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 7.8 SB_25441| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 7.8 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 174 bits (423), Expect = 8e-44 Identities = 85/104 (81%), Positives = 93/104 (89%), Gaps = 2/104 (1%) Frame = +3 Query: 213 QTREHLLVF-FTNQRFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNG 389 +T EH+ +F + FEIIDFFLG +L DEVLKIMPVQKQTRAGQRTRFKAFVAIGD+NG Sbjct: 24 KTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNG 83 Query: 390 HIGLGVKCSKEVATAIRGAIILAKLSVLPVRRGYWGNKIGS-HT 518 H+GLGVKCSKEVATAIRGAIILAKLSV+PVRRGYWGNKIG HT Sbjct: 84 HVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHT 127 Score = 133 bits (321), Expect = 2e-31 Identities = 59/83 (71%), Positives = 64/83 (77%) Frame = +2 Query: 509 KPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGVQDCYTSARGSTGTLGN 688 KPHTVPCKVTGKCGS VRLIPAPRGTGIVSAPVPKKLLQMAG++DCYTS RG T TLGN Sbjct: 124 KPHTVPCKVTGKCGSTRVRLIPAPRGTGIVSAPVPKKLLQMAGIEDCYTSTRGQTATLGN 183 Query: 689 FXXXXXXXXXXXXXXLTPDLWRD 757 F LTPD+W++ Sbjct: 184 FAKATFAAISETYAYLTPDMWKE 206 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 163 WVPVTKLGRLVREGKIDKLESIYLFSLPIKD 255 WVPVTKLGRLV++ KI LE IYLFSLPIK+ Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIKE 38 >SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -3 Query: 464 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLIIQG 285 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 235 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 292 Query: 284 RAEEEI 267 R ++E+ Sbjct: 293 RNQDEL 298 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -3 Query: 464 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLIIQG 285 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 519 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 576 Query: 284 RAEEEI 267 R ++E+ Sbjct: 577 RNQDEL 582 >SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033) Length = 382 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -1 Query: 187 GRVW*QEPTLSGLPCRAHDHGRDHDRVHEDRHGLYLH 77 G +W + L LP H DHDR H RH +H Sbjct: 103 GFLWQKNGVLLSLPPPQFRHSHDHDRHHYHRHHNNIH 139 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = -3 Query: 437 NGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL 306 N G LA + N+ +V NG K + C LS T L LY HDL Sbjct: 108 NAYGKSLAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 291 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 404 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 291 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 404 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 291 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 404 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 291 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 404 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 95 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 291 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 404 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_22198| Best HMM Match : Borrelia_orfA (HMM E-Value=5.4) Length = 394 Score = 29.1 bits (62), Expect = 4.5 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -1 Query: 667 TTS*RVAIL-YTSHLKKLLRNWRRHNTSTTRGRNQPDCYGTTLAGDLARDGVWLPILL 497 T S +++IL YT + + RN++ +NT T R Q + TT+ L D L ILL Sbjct: 183 TDSEKLSILVYTRNSTQTARNYQYYNTRKTL-RRQRETINTTIHAKLYTDSEKLSILL 239 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 291 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 404 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_11456| Best HMM Match : 7tm_1 (HMM E-Value=3.5e-40) Length = 391 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 612 GTGADTIPVPRG-AGISRTVTEPHLPVTLQGTVCGFLSCY 496 GT T+P G A ++ + E + TL TV GF++C+ Sbjct: 228 GTSGSTLPSNEGRANLTVNIEEVKVTKTLFATVVGFVTCW 267 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 7.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 341 TAHTFQGICCHWRQQRSYW 397 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_25441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 932 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +2 Query: 542 KCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGVQDCYTSARGSTGTLG 685 +CG+ + + R ++ P+P L ++ +Q C + STGT G Sbjct: 591 RCGTHALTKTVSERVPDVLKHPLPPPLQELQELQVCDPPSTSSTGTTG 638 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 28.3 bits (60), Expect = 7.8 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 339 GQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 428 G++ + K F+A+G NGH+ C ++A Sbjct: 356 GRKDKRKDFLALGLRNGHVEFRFSCGADIA 385 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,382,780 Number of Sequences: 59808 Number of extensions: 599748 Number of successful extensions: 1583 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1582 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2263654701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -